Lus10002658 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G10520 107 / 8e-28 RBK1 ROP binding protein kinases 1 (.1)
AT5G65530 99 / 8e-25 Protein kinase superfamily protein (.1)
AT3G05140 68 / 8e-14 RBK2 ROP binding protein kinases 2 (.1)
AT5G18910 67 / 1e-13 Protein kinase superfamily protein (.1)
AT1G21590 67 / 1e-13 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
AT2G18890 61 / 1e-11 Protein kinase superfamily protein (.1.2)
AT5G57670 61 / 2e-11 Protein kinase superfamily protein (.2)
AT5G35960 60 / 3e-11 Protein kinase family protein (.1)
AT5G62230 60 / 4e-11 ERL1 ERECTA-like 1 (.1.2)
AT1G49270 59 / 6e-11 AtPERK7 proline-rich extensin-like receptor kinase 7, Protein kinase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025713 226 / 2e-73 AT5G65530 461 / 8e-161 Protein kinase superfamily protein (.1)
Lus10035949 172 / 5e-52 AT5G65530 521 / 0.0 Protein kinase superfamily protein (.1)
Lus10012727 165 / 1e-48 AT5G65530 457 / 8e-157 Protein kinase superfamily protein (.1)
Lus10027964 102 / 6e-28 AT5G35960 163 / 7e-48 Protein kinase family protein (.1)
Lus10034000 69 / 4e-14 AT5G18910 568 / 0.0 Protein kinase superfamily protein (.1)
Lus10012776 68 / 1e-13 AT5G18910 568 / 0.0 Protein kinase superfamily protein (.1)
Lus10000773 66 / 3e-13 AT5G56790 74 / 2e-14 Protein kinase superfamily protein (.1)
Lus10003503 63 / 2e-12 AT1G72180 278 / 2e-87 Leucine-rich receptor-like protein kinase family protein (.1)
Lus10025468 63 / 3e-12 AT2G18890 258 / 6e-86 Protein kinase superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G011700 124 / 4e-34 AT5G10520 552 / 0.0 ROP binding protein kinases 1 (.1)
Potri.013G028100 73 / 1e-15 AT3G05140 548 / 0.0 ROP binding protein kinases 2 (.1)
Potri.014G136300 61 / 1e-11 AT5G35960 556 / 0.0 Protein kinase family protein (.1)
Potri.012G130400 61 / 2e-11 AT5G62230 1412 / 0.0 ERECTA-like 1 (.1.2)
Potri.010G027301 61 / 2e-11 AT5G18910 527 / 0.0 Protein kinase superfamily protein (.1)
Potri.006G173700 61 / 3e-11 AT5G57670 654 / 0.0 Protein kinase superfamily protein (.2)
Potri.004G105200 60 / 4e-11 AT5G38560 650 / 0.0 proline-rich extensin-like receptor kinase 8, Protein kinase superfamily protein (.1)
Potri.015G132200 59 / 7e-11 AT5G62230 1404 / 0.0 ERECTA-like 1 (.1.2)
Potri.017G110400 59 / 1e-10 AT5G38560 654 / 0.0 proline-rich extensin-like receptor kinase 8, Protein kinase superfamily protein (.1)
Potri.018G096100 59 / 1e-10 AT5G57670 619 / 0.0 Protein kinase superfamily protein (.2)
PFAM info
Representative CDS sequence
>Lus10002658 pacid=23168813 polypeptide=Lus10002658 locus=Lus10002658.g ID=Lus10002658.BGIv1.0 annot-version=v1.0
ATGTCTAGACTGGGAGAAAGATACAGAGCAGCAGTAGGAATTGCAGAGGGGCTAAGGTACCTTCACCATGATTGCCCGAGGCGTGTCATCCACCGTGACA
TCAAAGCTTCCAGCAGCTTGCTTGCTGAAGATTATGAAGCTCAGGCGAAACCATTGTTGGAAGCGAAGGACGCGAACACATTGGTGGATCCAAGGCTAGG
GAACGACTTCAACATGTCCGAAATGAAGCGAGCAATGGTGACGGCATTCTTGTGTATCGACCACGACTCGAAGATGCGACCTGCTATGACTCGGGCCGTG
CAAATACTCAACGGGGAAGACGTAGCCATTGGTGCTGTGATGGTACAGAAGACGAGCTCAGGGAGGGGCGATTTATTGGATGCTAGTGACTTGCAAGATT
ACACGTGTACTTCCAACTACCTCAACGACCTTAACCGTCATATGCAGCTTGTCATGGAATGA
AA sequence
>Lus10002658 pacid=23168813 polypeptide=Lus10002658 locus=Lus10002658.g ID=Lus10002658.BGIv1.0 annot-version=v1.0
MSRLGERYRAAVGIAEGLRYLHHDCPRRVIHRDIKASSSLLAEDYEAQAKPLLEAKDANTLVDPRLGNDFNMSEMKRAMVTAFLCIDHDSKMRPAMTRAV
QILNGEDVAIGAVMVQKTSSGRGDLLDASDLQDYTCTSNYLNDLNRHMQLVME

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G05140 RBK2 ROP binding protein kinases 2 ... Lus10002658 0 1

Lus10002658 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.