Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G00810 103 / 1e-29 60S acidic ribosomal protein family (.1.2) AT1G01100 102 / 2e-29 60S acidic ribosomal protein family (.1.2.3.4) AT5G47700 102 / 3e-29 60S acidic ribosomal protein family (.1.2) AT5G24510 95 / 1e-26 60S acidic ribosomal protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030200 [exp] 135 / 2e-38 AT1G05600 580 / 0.0 EMBRYO DEFECTIVE 3101, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10028876 [exp] 118 / 2e-35 AT5G24510 128 / 8e-40 60S acidic ribosomal protein family (.1) Lus10008944 [exp] 118 / 2e-35 AT5G24510 128 / 8e-40 60S acidic ribosomal protein family (.1) Lus10008943 [exp] 118 / 2e-35 AT5G24510 128 / 8e-40 60S acidic ribosomal protein family (.1) Lus10034864 [exp] 108 / 4e-32 AT5G24510 114 / 2e-34 60S acidic ribosomal protein family (.1) Lus10033403 [exp] 36 / 0.0008 AT5G47700 40 / 6e-09 60S acidic ribosomal protein family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G004700 [exp] 102 / 2e-29 AT1G01100 96 / 4e-27 60S acidic ribosomal protein family (.1.2.3.4) Potri.012G021700 [exp] 98 / 1e-27 AT5G24510 94 / 3e-26 60S acidic ribosomal protein family (.1) Potri.014G105400 [exp] 96 / 6e-27 AT5G24510 97 / 2e-27 60S acidic ribosomal protein family (.1) Potri.002G179400 [exp] 90 / 1e-24 AT5G24510 99 / 3e-28 60S acidic ribosomal protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00428 [flax] [poplar] Ribosomal_60s 60s Acidic ribosomal protein
Representative CDS sequence Show only first row Show all	>Lus10002680 pacid=23159055 polypeptide=Lus10002680 locus=Lus10002680.g ID=Lus10002680.BGIv1.0 annot-version=v1.0 ATGTCGGTCGGAGAAATCGCTTGCAGTTACGCCATCATGATCCTTCATGACGAAGGCATCCCCATCACCTCGGACAAAATCAGCACTCTGGTTAAGGCAG CTAACGTCAACTGCGAGTCCTACTGGCCCAGTTTGTTCGCCAAGTTGGCTGAGAAGAGGAACGTCGAGGATCTCATCATGAACGCTTGCGCTGGAGGCGG CGGTGGTGTTGCTGCCGTCGCTGCTCCGGCCGCTGCTCCGTCTGGTGGTCCCGCTGCTCCTGCAGCTGCAGCCGCCCCTGCTGCTGAAGAGAAGAAGGAG GAGGCCAAAGAGGAGAGTGACGAAGACATGGGTTTCTCCTTGTTCGATTAG
AA sequence Show only first row Show all	>Lus10002680 pacid=23159055 polypeptide=Lus10002680 locus=Lus10002680.g ID=Lus10002680.BGIv1.0 annot-version=v1.0 MSVGEIACSYAIMILHDEGIPITSDKISTLVKAANVNCESYWPSLFAKLAEKRNVEDLIMNACAGGGGGVAAVAAPAAAPSGGPAAPAAAAAPAAEEKKE EAKEESDEDMGFSLFD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G24510			60S acidic ribosomal protein f...		Lus10002680 [exp]	0	1
AT3G05560			Ribosomal L22e protein family ...		Lus10026555 [exp]	1.0	0.9122
AT1G05600		EMB3101	EMBRYO DEFECTIVE 3101, Tetratr...		Lus10030200 [exp]	2.4	0.8735
AT5G24510			60S acidic ribosomal protein f...		Lus10008944 [exp]	4.5	0.8251
AT2G03510			SPFH/Band 7/PHB domain-contain...		Lus10004648 [exp]	5.5	0.8366
AT4G25740			RNA binding Plectin/S10 domain...		Lus10014966 [exp]	5.8	0.7771
AT3G10090			Nucleic acid-binding, OB-fold-...		Lus10017293 [exp]	6.3	0.7994
AT5G27700			Ribosomal protein S21e (.1)		Lus10020645 [exp]	6.9	0.8271
AT1G09640			Translation elongation factor ...		Lus10007150 [exp]	8.7	0.7539
AT4G31985			Ribosomal protein L39 family p...		Lus10019065 [exp]	11.3	0.7817
AT4G15770			RNA binding (.1)		Lus10000507 [exp]	11.4	0.7981

Compare expression of checked genes

Lus10002680 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.