Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G05600 141 / 1e-40 EMB3101 EMBRYO DEFECTIVE 3101, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT5G46100 88 / 4e-21 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G64583 82 / 5e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G01110 82 / 8e-19 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G07290 81 / 1e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G40400 81 / 1e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G53700 81 / 2e-18 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G52620 81 / 3e-18 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G64100 79 / 8e-18 pentatricopeptide (PPR) repeat-containing protein (.1), pentatricopeptide (PPR) repeat-containing protein (.2) AT1G09900 78 / 1e-17 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030200 [exp] 272 / 3e-89 AT1G05600 580 / 0.0 EMBRYO DEFECTIVE 3101, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10008593 [exp] 94 / 8e-23 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10036865 [exp] 90 / 1e-21 AT1G12700 273 / 1e-83 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10009201 [exp] 87 / 6e-21 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10021074 [exp] 87 / 8e-21 AT1G62930 273 / 5e-86 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027914 [exp] 87 / 1e-20 AT5G39710 1025 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027916 [exp] 87 / 1e-20 AT5G39710 1038 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013077 [exp] 87 / 2e-20 AT5G40400 587 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10012068 [exp] 86 / 4e-20 AT5G39710 1028 / 0.0 EMBRYO DEFECTIVE 2745, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G179300 [exp] 152 / 1e-44 AT1G05600 649 / 0.0 EMBRYO DEFECTIVE 3101, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.005G046100 [exp] 94 / 6e-23 AT1G12700 512 / 1e-173 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.011G057900 [exp] 89 / 3e-21 AT5G46100 627 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G038400 [exp] 89 / 3e-21 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G034200 [exp] 87 / 1e-20 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050400 [exp] 86 / 3e-20 AT1G12700 504 / 3e-171 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050240 [exp] 85 / 6e-20 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G032600 [exp] 85 / 7e-20 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G050500 [exp] 85 / 7e-20 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.014G105900 [exp] 84 / 2e-19 AT4G01400 576 / 0.0 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10002681 pacid=23159061 polypeptide=Lus10002681 locus=Lus10002681.g ID=Lus10002681.BGIv1.0 annot-version=v1.0 ATGGTGAGGGTGAATTGTTTGCCAACGGTACGAGTGTATAATTTTCTACTGAAAGGACTGTGCGAGAACGGCAATTCGGTGATGGGTGTCGAGTATCTTG ATAAGATGGGGAAGCAGGTGGGGTGTGTGGCTGACTGTGAAACCTATGCGACTTTGGTGCGTGGGTTGTGCAAGGAAGGGAGGTTTGTCGAGGCGAGTGG TGTTCTGGAACGGATGCTGAGGAGGCGTGTTCGGCCTGACGTTGGTGTGTATGAGATGGTTGTGCATGGTCTTTGTCGGGTGGGTAGACGGTATGATGCG GTGGCGGTGCTGGAGGAGATGATTGATCAAGGTGAGGTGCCGGATGTTTTGCTGTGGGGGTCCTTGGTTGCTTCTGCTTGTTATCATATGGCTAATGTTG ATGTTTGTTCTCAGAGAGTTCTGCAGATTAGCCAGTAG
AA sequence Show only first row Show all	>Lus10002681 pacid=23159061 polypeptide=Lus10002681 locus=Lus10002681.g ID=Lus10002681.BGIv1.0 annot-version=v1.0 MVRVNCLPTVRVYNFLLKGLCENGNSVMGVEYLDKMGKQVGCVADCETYATLVRGLCKEGRFVEASGVLERMLRRRVRPDVGVYEMVVHGLCRVGRRYDA VAVLEEMIDQGEVPDVLLWGSLVASACYHMANVDVCSQRVLQISQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G05600		EMB3101	EMBRYO DEFECTIVE 3101, Tetratr...		Lus10002681 [exp]	0	1
AT4G04614			unknown protein		Lus10014685 [exp]	1.4	0.8276
AT5G53940			Yippee family putative zinc-bi...		Lus10015416 [exp]	3.5	0.8227
AT2G29590			Thioesterase superfamily prote...		Lus10018205 [exp]	6.2	0.8219
AT5G07670			RNI-like superfamily protein (...		Lus10031164 [exp]	8.1	0.7728
AT5G16780		MDF, DOT2	MERISTEM-DEFECTIVE, DEFECTIVEL...		Lus10000639 [exp]	10.2	0.8071
AT1G16810			unknown protein		Lus10033383 [exp]	14.3	0.8056
AT5G27720		LSM4, EMB1644	SM-like protein 4, embryo defe...		Lus10004221 [exp]	17.3	0.8089
AT1G04290			Thioesterase superfamily prote...		Lus10019228 [exp]	24.8	0.8031
AT2G29540		ATRPAC14, ATRPC...	RNApolymerase 14 kDa subunit (...		Lus10040717 [exp]	31.3	0.7791
AT5G16780		MDF, DOT2	MERISTEM-DEFECTIVE, DEFECTIVEL...		Lus10023155 [exp]	33.4	0.7307

Compare expression of checked genes

Lus10002681 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.