Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14430 61 / 3e-14 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030201 [exp] 117 / 2e-36 AT3G14430 89 / 3e-25 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G105250 [exp] 64 / 2e-15 AT3G14430 50 / 1e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002683 pacid=23159065 polypeptide=Lus10002683 locus=Lus10002683.g ID=Lus10002683.BGIv1.0 annot-version=v1.0 ATGGCGATGAGCAGCAGCAGGCAGGGAAGGACAATAGGAGGACGAAGAAGGGAAGAGCCAATGCTGACTCGTATGGTCACTGCAGTATTTTCCTTCGTCA AGTACGCTGAATTCGAGATCCTCTTTGTTCTTTTCATCCTCATTGCCTTTCTTGTCTTCAAAGATCTCACCTCAAGGCCCGAGTACAATCAAATCCTGGT GAAGAAGCCCGACAGTGGCGACTGGTGGCCTTACTAG
AA sequence Show only first row Show all	>Lus10002683 pacid=23159065 polypeptide=Lus10002683 locus=Lus10002683.g ID=Lus10002683.BGIv1.0 annot-version=v1.0 MAMSSSRQGRTIGGRRREEPMLTRMVTAVFSFVKYAEFEILFVLFILIAFLVFKDLTSRPEYNQILVKKPDSGDWWPY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14430			unknown protein		Lus10002683 [exp]	0	1
AT3G14430			unknown protein		Lus10030201 [exp]	1.4	0.8392
AT1G17455		ELF4-L4	ELF4-like 4 (.1.2)		Lus10000371 [exp]	2.0	0.8444
AT4G39235			unknown protein		Lus10021065 [exp]	7.5	0.8309
AT5G41560			unknown protein		Lus10028758 [exp]	11.8	0.8178
AT1G25682			Family of unknown function (DU...		Lus10034268 [exp]	20.2	0.8232
AT5G57860			Ubiquitin-like superfamily pro...		Lus10035816 [exp]	20.2	0.8120
AT2G04900			unknown protein		Lus10001166 [exp]	23.8	0.8050
AT2G46410	MYB	CPC	CAPRICE, Homeodomain-like supe...		Lus10018366 [exp]	27.2	0.7944
AT4G14710		ATARD2	RmlC-like cupins superfamily p...		Lus10039375 [exp]	34.1	0.8273
AT5G09260		VPS20.2	vacuolar protein sorting-assoc...		Lus10037699 [exp]	34.8	0.8046

Compare expression of checked genes

Lus10002683 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.