Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61930 45 / 4e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030203 [exp] 185 / 2e-62 AT3G61930 44 / 1e-06 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G179000 [exp] 56 / 2e-11 AT3G61930 51 / 2e-09 unknown protein Potri.014G105000 [exp] 56 / 3e-11 AT3G61930 43 / 3e-06 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002685 pacid=23159052 polypeptide=Lus10002685 locus=Lus10002685.g ID=Lus10002685.BGIv1.0 annot-version=v1.0 ATGGGCAATCGACAAGGAAGAAATGCGGCGGTGCAACCATTGAATTACCAAGGAGGTGACGGCGAGGACGCGGCCATAACAGAGCTTCTCTCTCCGGCTC CGACTAGGAGTAGTAATCCTAATGGTGTTAGGATTCGAGTAGGGATGACCATGGGGCAACTTCACGAGTTGATGACTCAAATTCCGACATCGAAGTCAAG GGGTAGCAACGAGTGTTCATCGTCGGAGCTCGGTCGATTGATCCTCCGAGAATGCCTAAAGGGTAGGTTTCGAGCTCGTGTTGTCGGCGTCCTCCCTCCA TTTTCGACCCACGAAGACTAA
AA sequence Show only first row Show all	>Lus10002685 pacid=23159052 polypeptide=Lus10002685 locus=Lus10002685.g ID=Lus10002685.BGIv1.0 annot-version=v1.0 MGNRQGRNAAVQPLNYQGGDGEDAAITELLSPAPTRSSNPNGVRIRVGMTMGQLHELMTQIPTSKSRGSNECSSSELGRLILRECLKGRFRARVVGVLPP FSTHED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G61930			unknown protein		Lus10002685 [exp]	0	1
AT5G02640			unknown protein		Lus10023327 [exp]	3.2	0.8600
AT2G44130			Galactose oxidase/kelch repeat...		Lus10016214 [exp]	4.5	0.8286
AT3G61930			unknown protein		Lus10030203 [exp]	4.8	0.8861
AT4G26410			Uncharacterised conserved prot...		Lus10034621 [exp]	15.6	0.7791
AT2G01300			unknown protein		Lus10002277 [exp]	19.6	0.7978
AT4G28530	NAC	ANAC074	NAC domain containing protein ...		Lus10022915 [exp]	21.4	0.8171
AT2G28420		GLYI8	glyoxylase I 8, Lactoylglutath...		Lus10005324 [exp]	30.4	0.7643
AT1G70670		AtCLO4	Arabidopsis thaliana caleosin ...		Lus10014588 [exp]	31.7	0.8348
AT2G42590		GENERALREGULATO...	general regulatory factor 9 (....		Lus10033609 [exp]	42.4	0.8111
AT5G50260		CEP1	cysteine endopeptidase 1, Cyst...		Lus10042078 [exp]	44.7	0.8145

Compare expression of checked genes

Lus10002685 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.