Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61920 57 / 2e-11 unknown protein AT1G64700 52 / 3e-09 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030204 [exp] 153 / 7e-49 AT3G61920 59 / 4e-11 unknown protein Lus10008274 [exp] 47 / 3e-07 AT1G64700 118 / 9e-33 unknown protein Lus10001663 [exp] 42 / 9e-06 AT1G64700 138 / 1e-40 unknown protein Lus10017341 [exp] 41 / 1e-05 AT1G64700 56 / 2e-10 unknown protein Lus10032411 [exp] 37 / 0.001 AT3G61920 73 / 4e-16 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G178900 [exp] 70 / 3e-16 AT3G61920 142 / 6e-43 unknown protein Potri.014G104900 [exp] 69 / 1e-15 AT3G61920 130 / 4e-38 unknown protein Potri.011G153000 [exp] 56 / 6e-11 AT1G64700 160 / 1e-49 unknown protein Potri.001G448500 [exp] 52 / 3e-09 AT1G64700 154 / 3e-47 unknown protein Potri.001G089000 [exp] 42 / 8e-06 AT3G61920 81 / 5e-19 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002686 pacid=23159064 polypeptide=Lus10002686 locus=Lus10002686.g ID=Lus10002686.BGIv1.0 annot-version=v1.0 ATGGGCAACTGCCTCTTCAACGGTCTACCGGACGAGGCGGCCGCCCAAAACGACGCCGTCGTAAGAAAGGACGTCACGTACATCATCGAAGTCGTCGTAC CAAACGGCCCTGCCACCGCCTCACCGGAGGTGATATGGAGGTACAGCGGGAGCGGGGTGTGGAAGGTGAAGCTGGTGATGAGTGCGGCGGAGCTGGCCGA GATACTGGCGGAGGATTCACGGACGGAGGAGCTGATTGAGAGCGTCAGGACGGTGGCGAAAGGTGGCGGCCGGAAGAATATATAA
AA sequence Show only first row Show all	>Lus10002686 pacid=23159064 polypeptide=Lus10002686 locus=Lus10002686.g ID=Lus10002686.BGIv1.0 annot-version=v1.0 MGNCLFNGLPDEAAAQNDAVVRKDVTYIIEVVVPNGPATASPEVIWRYSGSGVWKVKLVMSAAELAEILAEDSRTEELIESVRTVAKGGGRKNI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G61920			unknown protein		Lus10002686 [exp]	0	1
AT3G08690		ATUBC11, UBC11	ubiquitin-conjugating enzyme 1...		Lus10007126 [exp]	2.0	0.8802
AT5G56150		UBC30	ubiquitin-conjugating enzyme 3...		Lus10016670 [exp]	5.8	0.8619
AT3G16500	AUX_IAA	IAA26, PAP1	indole-3-acetic acid inducible...		Lus10037587 [exp]	8.8	0.8109
AT5G17850			Sodium/calcium exchanger famil...		Lus10013634 [exp]	9.4	0.8338
AT1G13970			Protein of unknown function (D...		Lus10030425 [exp]	9.5	0.8088
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10008893 [exp]	12.1	0.8501
AT3G61920			unknown protein		Lus10030204 [exp]	16.5	0.8167
					Lus10008223 [exp]	19.8	0.7973
AT1G14630			unknown protein		Lus10039139 [exp]	22.6	0.8273
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10023213 [exp]	22.7	0.8268

Compare expression of checked genes

Lus10002686 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.