Lus10002693 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G01150 52 / 2e-08 Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000100 213 / 3e-72 ND 39 / 4e-04
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G104100 64 / 3e-14 ND /
Potri.002G177700 61 / 4e-13 ND /
PFAM info
Representative CDS sequence
>Lus10002693 pacid=23159074 polypeptide=Lus10002693 locus=Lus10002693.g ID=Lus10002693.BGIv1.0 annot-version=v1.0
ATGGGGAGGGACAAGGAAGATAACAATGATAATGTGGGAGATCATGGAGAAGAAGGGAGTAGTATGAGTAGGAGGAATATAACAAAGTGGATGATGAGGA
AGGATGGAACGGCGTCGTTTTGGTGTATCGGATGTGGAATATTGAGCTTGGTGGGAGGTGTGGTTTTGGGCTGGTGGGAGTACAAGTATCATCGAACCAA
CTCTCAACAATGGATGGTTCCCTTTGGTTTGATTTTGTTCGCAACTCCCTTGTTCGTTTGGCTCGCAGTTATCGTCTCTGATTTTTGCAACGAAGAAGAC
GGTCTTGGTGGCGGCGGCGGAGGGTCACCGGAGACCACGGGTCAAGTCGTGGTGTGTGACTCGGTAGTGAGGATGAATAATAAAGATGTCACAACTTTGT
ACCATATGAAAGGAGAAAATATAGTGTGA
AA sequence
>Lus10002693 pacid=23159074 polypeptide=Lus10002693 locus=Lus10002693.g ID=Lus10002693.BGIv1.0 annot-version=v1.0
MGRDKEDNNDNVGDHGEEGSSMSRRNITKWMMRKDGTASFWCIGCGILSLVGGVVLGWWEYKYHRTNSQQWMVPFGLILFATPLFVWLAVIVSDFCNEED
GLGGGGGGSPETTGQVVVCDSVVRMNNKDVTTLYHMKGENIV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10002693 0 1
AT2G40200 bHLH bHLH051 basic helix-loop-helix (bHLH) ... Lus10013917 2.6 0.9529
AT5G65980 Auxin efflux carrier family pr... Lus10012708 3.7 0.9504
AT3G22600 Bifunctional inhibitor/lipid-t... Lus10010573 6.0 0.9267
AT1G19630 CYP722A1 "cytochrome P450, family 722, ... Lus10025991 7.1 0.9436
AT1G12110 CHL1-1, CHL1, B... CHLORINA 1, ARABIDOPSIS THALIA... Lus10032252 10.0 0.9468
AT5G45290 RING/U-box superfamily protein... Lus10016428 10.4 0.9418
AT5G13750 ZIFL1 zinc induced facilitator-like ... Lus10034847 10.8 0.9492
AT1G19630 CYP722A1 "cytochrome P450, family 722, ... Lus10025990 12.2 0.9372
AT2G16750 Protein kinase protein with ad... Lus10014122 14.5 0.9359
AT5G08300 Succinyl-CoA ligase, alpha sub... Lus10006405 16.6 0.9230

Lus10002693 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.