Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15020 49 / 5e-08 hAT transposon superfamily (.1.2) AT3G22220 43 / 6e-06 hAT transposon superfamily (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000517 [exp] 79 / 9e-20 AT4G15020 122 / 8e-33 hAT transposon superfamily (.1.2)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002709 pacid=23180558 polypeptide=Lus10002709 locus=Lus10002709.g ID=Lus10002709.BGIv1.0 annot-version=v1.0 ATGGCAAAGAAAGAAGAAGAGGACACCTCGGATCCTTTGTCATTTGATAGCATTAGCTTTCTGGAGGACTGGGTGAAAGGAGTAGACATGAACACGGACT GTGATTGGGCAGTTCTTGATCCTCTTCCTGCTAACAAGATGGTGTTAGGACCTCTTGTAGATGAAATTGAAGAGTTAGGGTTCGATGATGACGAGATATT TAGTAGAGCAAAGGAAGGCATGGAAGAAAAGATTGAAGAGGATGCAGTAGTGTTGCAACATACCATTGAAGGTTCTGCTGATATATTTCCAATTTGA
AA sequence Show only first row Show all	>Lus10002709 pacid=23180558 polypeptide=Lus10002709 locus=Lus10002709.g ID=Lus10002709.BGIv1.0 annot-version=v1.0 MAKKEEEDTSDPLSFDSISFLEDWVKGVDMNTDCDWAVLDPLPANKMVLGPLVDEIEELGFDDDEIFSRAKEGMEEKIEEDAVVLQHTIEGSADIFPI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15020			hAT transposon superfamily (.1...		Lus10002709 [exp]	0	1
AT1G66370	MYB	ATMYB113	myb domain protein 113 (.1)		Lus10028514 [exp]	6.0	0.8396
AT3G49055			unknown protein		Lus10021563 [exp]	8.9	0.6922
AT1G77410		BGAL16	beta-galactosidase 16 (.1)		Lus10033427 [exp]	12.2	0.8389
					Lus10040989 [exp]	15.0	0.7395
AT2G38150			alpha 1,4-glycosyltransferase ...		Lus10035525 [exp]	15.1	0.8375
					Lus10003755 [exp]	18.3	0.8343
AT2G38150			alpha 1,4-glycosyltransferase ...		Lus10027771 [exp]	21.2	0.8275
AT5G15740		RRT1	O-fucosyltransferase family pr...		Lus10036832 [exp]	22.8	0.8209
AT5G64330		JK218, RPT3, NP...	ROOT PHOTOTROPISM 3, NON-PHOTO...		Lus10015190 [exp]	23.3	0.8030
AT4G25140		OLE1, OLEO1	oleosin 1 (.1)		Lus10031387 [exp]	27.7	0.7553

Compare expression of checked genes

Lus10002709 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.