Lus10002712 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44920 269 / 3e-92 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G12250 63 / 4e-12 Pentapeptide repeat-containing protein (.1.2)
AT5G55000 59 / 2e-10 FIP2 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000520 329 / 3e-116 AT2G44920 286 / 6e-99 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10024602 58 / 5e-10 AT1G12250 354 / 1e-123 Pentapeptide repeat-containing protein (.1.2)
Lus10032239 58 / 5e-10 AT1G12250 357 / 9e-125 Pentapeptide repeat-containing protein (.1.2)
Lus10020270 52 / 1e-07 AT5G55000 430 / 2e-149 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Lus10002622 49 / 5e-07 AT5G55000 462 / 1e-165 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Lus10007788 42 / 0.0001 AT5G53490 301 / 2e-104 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G200000 286 / 4e-99 AT2G44920 256 / 4e-87 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.008G058800 284 / 3e-98 AT2G44920 253 / 1e-85 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.003G112900 64 / 4e-12 AT1G12250 363 / 1e-128 Pentapeptide repeat-containing protein (.1.2)
Potri.013G062500 50 / 3e-07 AT5G55000 413 / 2e-146 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Potri.019G038400 49 / 8e-07 AT5G55000 414 / 1e-146 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Potri.012G018100 42 / 0.0002 AT5G53490 318 / 1e-110 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0505 Pentapeptide PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Representative CDS sequence
>Lus10002712 pacid=23180557 polypeptide=Lus10002712 locus=Lus10002712.g ID=Lus10002712.BGIv1.0 annot-version=v1.0
ATGAATCTTCTTCTGAATGTCTCGCTCTGTACGGCTAAAACCCCACCAAAACCCTCACTTCCACTCCTTCCAAGCCCTCCTCAACCCCCACTTTCTCTTT
CTTTGCCCCGTTCCCAGGTGTTACGAGACTTGGCTAAAACAAGCTTGCTTGCAGTGCTATCCGCCTCTGTCTTCCTCTCTGACCCTGCTCTCGCATACAA
GGGAGGAGGTCCATACGGTTCTGAGGTGACCAGGGGCCAGGATCTGACTGGCAAGGACTTCAGTGGCAAGACTTTGATCAAGCAGGACTTTAAGACGTCA
ATTCTAAGGCAAGCCAATTTCAAAGGTGCAAAGTTGCTCGGGGCTAGCTTCTTTGATGCTGATTTGACTGGAGCCGATCTTTCGAATGCAGACCTTAGAG
GAGTAGATTTCTCCTTGGCCAATGTGACAAAGGTGAATTTGAGCAATGCGAACCTAGAAGGCGCTCTAACCACAGGCAATACTTCATTCAAGGGCTCAAA
CATAGCAGGAGCAGATTTCACTGATGTGCCTCTACGGGAGGATCAGCGTGAATACCTTTGCAAAATTGCAGATGGGGTGAACCCAACTACTGGAAACGCG
ACCCGTGAGACACTACTTTGTAACTAA
AA sequence
>Lus10002712 pacid=23180557 polypeptide=Lus10002712 locus=Lus10002712.g ID=Lus10002712.BGIv1.0 annot-version=v1.0
MNLLLNVSLCTAKTPPKPSLPLLPSPPQPPLSLSLPRSQVLRDLAKTSLLAVLSASVFLSDPALAYKGGGPYGSEVTRGQDLTGKDFSGKTLIKQDFKTS
ILRQANFKGAKLLGASFFDADLTGADLSNADLRGVDFSLANVTKVNLSNANLEGALTTGNTSFKGSNIAGADFTDVPLREDQREYLCKIADGVNPTTGNA
TRETLLCN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44920 Tetratricopeptide repeat (TPR)... Lus10002712 0 1
AT5G06920 FLA21 FASCICLIN-like arabinogalactan... Lus10020296 2.4 0.9408
AT5G64040 PSAN, PSI-N photosystem I reaction center ... Lus10003849 3.5 0.9518
AT2G42220 Rhodanese/Cell cycle control p... Lus10021032 6.3 0.9504
AT2G44920 Tetratricopeptide repeat (TPR)... Lus10000520 6.9 0.9432
Lus10023773 7.3 0.9305
Lus10011047 7.9 0.9294
AT1G52230 PSAH2, PSAH-2, ... PHOTOSYSTEM I SUBUNIT H-2, pho... Lus10025798 10.1 0.9453
AT2G35500 SKL2 shikimate kinase-like 2, shiki... Lus10035389 11.5 0.9288
AT5G64040 PSAN, PSI-N photosystem I reaction center ... Lus10002084 11.8 0.9432
AT3G61080 Protein kinase superfamily pro... Lus10041374 14.4 0.9342

Lus10002712 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.