Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G42620 83 / 7e-20 PPS, PP2, ORE9, MAX2 PLEIOTROPIC PHOTOSIGNALING, ORESARA 9, MORE AXILLARY BRANCHES 2, RNI-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040230 [exp] 199 / 1e-67 AT2G42620 84 / 4e-20 PLEIOTROPIC PHOTOSIGNALING, ORESARA 9, MORE AXILLARY BRANCHES 2, RNI-like superfamily protein (.1) Lus10020707 [exp] 129 / 6e-36 AT2G42620 845 / 0.0 PLEIOTROPIC PHOTOSIGNALING, ORESARA 9, MORE AXILLARY BRANCHES 2, RNI-like superfamily protein (.1) Lus10029834 [exp] 128 / 2e-35 AT2G42620 843 / 0.0 PLEIOTROPIC PHOTOSIGNALING, ORESARA 9, MORE AXILLARY BRANCHES 2, RNI-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G142600 [exp] 87 / 3e-21 AT2G42620 854 / 0.0 PLEIOTROPIC PHOTOSIGNALING, ORESARA 9, MORE AXILLARY BRANCHES 2, RNI-like superfamily protein (.1) Potri.011G066700 [exp] 74 / 2e-16 AT2G42620 717 / 0.0 PLEIOTROPIC PHOTOSIGNALING, ORESARA 9, MORE AXILLARY BRANCHES 2, RNI-like superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002715 pacid=23158715 polypeptide=Lus10002715 locus=Lus10002715.g ID=Lus10002715.BGIv1.0 annot-version=v1.0 ATGACCACCGCAGAATCTCCGGCGAAAACAATCAACGATCTTCCCGATGTCACTCTCTTCGAGATATACGCCGCCGTCTCCGACACTCGAGCTCGCAACT CCCTCGCCCTCTTGAACCACAAGTTCCACACCCTTGAGCGCTCCACGCTCTACTCCCTCACGATGCGGGGAAACGCGCGAGATCTCTTCCTCGTCCCGTC CTGCTTCCGATCGAAGAATGGAATGAAGAAGAAAACAGCAGCAGCTGCAACTAAGGATGAGGAAGATGATCATTCTGCAGTTGCTCTGAGTGTTAACGGA AGGAAGGAAGAGTTCACTAACGGCGTCAAATGA
AA sequence Show only first row Show all	>Lus10002715 pacid=23158715 polypeptide=Lus10002715 locus=Lus10002715.g ID=Lus10002715.BGIv1.0 annot-version=v1.0 MTTAESPAKTINDLPDVTLFEIYAAVSDTRARNSLALLNHKFHTLERSTLYSLTMRGNARDLFLVPSCFRSKNGMKKKTAAAATKDEEDDHSAVALSVNG RKEEFTNGVK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G42620		PPS, PP2, ORE9,...	PLEIOTROPIC PHOTOSIGNALING, OR...		Lus10002715 [exp]	0	1
AT2G42620		PPS, PP2, ORE9,...	PLEIOTROPIC PHOTOSIGNALING, OR...		Lus10040230 [exp]	1.0	0.8480
					Lus10027235 [exp]	2.8	0.7910
AT1G13570			F-box/RNI-like superfamily pro...		Lus10020638 [exp]	5.7	0.7205
AT2G22620			Rhamnogalacturonate lyase fami...		Lus10023106 [exp]	10.2	0.7184
					Lus10008904 [exp]	13.0	0.7079
AT4G12290			Copper amine oxidase family pr...		Lus10024571 [exp]	33.3	0.5069
					Lus10029249 [exp]	33.7	0.6684
					Lus10009393 [exp]	36.6	0.6700
AT5G65020		ANNAT2	annexin 2 (.1.2)		Lus10024054 [exp]	38.7	0.5928
					Lus10029072 [exp]	41.2	0.6635

Compare expression of checked genes

Lus10002715 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.