Lus10002717 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G11340 81 / 5e-18 S-locus lectin protein kinase family protein (.1)
AT1G11410 79 / 3e-17 S-locus lectin protein kinase family protein (.1)
AT1G67520 67 / 3e-13 lectin protein kinase family protein (.1)
AT4G21390 67 / 7e-13 B120 S-locus lectin protein kinase family protein (.1)
AT4G27290 66 / 1e-12 S-locus lectin protein kinase family protein (.1)
AT4G21380 66 / 1e-12 ARK3 receptor kinase 3 (.1)
AT1G61610 66 / 2e-12 S-locus lectin protein kinase family protein (.1)
AT1G11280 64 / 5e-12 S-locus lectin protein kinase family protein (.1.2.3.4)
AT4G27300 63 / 1e-11 S-locus lectin protein kinase family protein (.1)
AT1G11300 63 / 2e-11 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020078 90 / 4e-22 AT1G11340 257 / 1e-80 S-locus lectin protein kinase family protein (.1)
Lus10006745 87 / 4e-20 AT1G11340 774 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10020052 87 / 9e-20 AT1G11340 858 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10006746 86 / 2e-19 AT1G11340 836 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10013246 75 / 1e-15 AT1G11340 678 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10013244 74 / 1e-15 AT1G11340 669 / 0.0 S-locus lectin protein kinase family protein (.1)
Lus10025512 74 / 3e-15 AT1G11340 530 / 5e-177 S-locus lectin protein kinase family protein (.1)
Lus10018405 72 / 1e-14 AT4G21380 952 / 0.0 receptor kinase 3 (.1)
Lus10013245 72 / 1e-14 AT1G11300 955 / 0.0 protein serine/threonine kinases;protein kinases;ATP binding;sugar binding;kinases;carbohydrate binding (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G028701 76 / 4e-16 AT1G11340 899 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.010G015400 74 / 1e-15 AT4G27290 683 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.010G018600 74 / 1e-15 AT4G27290 853 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.004G028466 74 / 2e-15 AT1G11340 884 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.004G028600 74 / 2e-15 AT1G11340 875 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.004G024140 72 / 8e-15 AT4G23180 497 / 3e-168 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G023700 72 / 1e-14 AT4G05200 474 / 3e-159 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.010G025800 71 / 1e-14 AT4G27290 828 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.010G025700 71 / 2e-14 AT4G27290 576 / 0.0 S-locus lectin protein kinase family protein (.1)
Potri.011G035700 71 / 2e-14 AT1G11340 743 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info
Representative CDS sequence
>Lus10002717 pacid=23158706 polypeptide=Lus10002717 locus=Lus10002717.g ID=Lus10002717.BGIv1.0 annot-version=v1.0
ATGAGCTGGAGGGACGAATCGAAGCGACATGGGGCTGAATCTCAGTGGATCGTGGCAGCAAGGTCACTCTGCCACTTACAATACCTTGTCACGTATTTAA
GTCGTCTGCAAATGATTCTATCCGCTGCTCGGTGGAAATTAAACTTCAAGGCGGCCCGATGGACTCTTCCGGCCAACGGACTTGGCCAACGACACGTGCC
TTTGGGGGCCGGATGGCCCCTACTGCTGGTCGGCAATCGGGCAGCGGACACAGGCGTCGGTGCCAGCCCGGATTCTGACTTAGAGGCGTTCAGTCATAAT
CCAGCGCACGGTAGCTTCGCGCCACTGGCTTTTCAACCAAGCGCGATGACCAATTACGAATCCATCATAATAAGCGAAGTGAGAGGGAATTCACATTTAC
CCTTCTTATCGCTGGATGAGGTCGTTGCTGCCACAAACAATTTCTCCGATAAGAATAGACTTGGAGTGGGTGGCTTTGGCGTCTACCAGGGAGTCGAGGA
ATCCAAGAACGAGGTGGAGCTGATTGCAAAGCTACAACCCAGCAATCTAGTTAAGATTTTGGGTTGTGTTGTGCAAGGACAATAG
AA sequence
>Lus10002717 pacid=23158706 polypeptide=Lus10002717 locus=Lus10002717.g ID=Lus10002717.BGIv1.0 annot-version=v1.0
MSWRDESKRHGAESQWIVAARSLCHLQYLVTYLSRLQMILSAARWKLNFKAARWTLPANGLGQRHVPLGAGWPLLLVGNRAADTGVGASPDSDLEAFSHN
PAHGSFAPLAFQPSAMTNYESIIISEVRGNSHLPFLSLDEVVAATNNFSDKNRLGVGGFGVYQGVEESKNEVELIAKLQPSNLVKILGCVVQGQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G11340 S-locus lectin protein kinase ... Lus10002717 0 1
Lus10030678 1.4 0.9806
Lus10007187 2.0 0.9772
Lus10000299 2.4 0.7875
Lus10001550 3.5 0.9505
Lus10008011 4.9 0.8659
AT2G20710 Tetratricopeptide repeat (TPR)... Lus10016229 5.2 0.7370
Lus10000298 18.2 0.8020
AT4G27410 NAC RD26, ANAC072 NAC (No Apical Meristem) domai... Lus10003458 18.3 0.6994
Lus10007186 33.5 0.7526
Lus10039450 34.2 0.7069

Lus10002717 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.