Lus10002722 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G20010 57 / 2e-09 PTAC9, OSB2 ORGANELLAR SINGLE-STRANDED DNA BINDING PROTEIN 2, plastid transcriptionally active 9 (.1.2)
AT5G44785 55 / 9e-09 OSB3 organellar single-stranded DNA binding protein 3 (.1.2)
AT1G47720 49 / 6e-07 OSB1 Organellar Single-stranded, Primosome PriB/single-strand DNA-binding (.1)
AT1G31010 49 / 9e-07 OSB4 organellar single-stranded DNA binding protein 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014728 287 / 5e-98 AT1G47720 106 / 3e-27 Organellar Single-stranded, Primosome PriB/single-strand DNA-binding (.1)
Lus10018763 209 / 5e-67 AT1G47720 109 / 3e-28 Organellar Single-stranded, Primosome PriB/single-strand DNA-binding (.1)
Lus10024852 198 / 6e-63 AT1G47720 110 / 2e-28 Organellar Single-stranded, Primosome PriB/single-strand DNA-binding (.1)
Lus10032760 59 / 3e-10 AT1G47720 74 / 2e-15 Organellar Single-stranded, Primosome PriB/single-strand DNA-binding (.1)
Lus10021767 55 / 1e-08 AT1G47720 124 / 1e-31 Organellar Single-stranded, Primosome PriB/single-strand DNA-binding (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G045100 202 / 1e-64 AT1G47720 112 / 2e-29 Organellar Single-stranded, Primosome PriB/single-strand DNA-binding (.1)
Potri.005G218100 186 / 3e-58 AT1G47720 114 / 6e-30 Organellar Single-stranded, Primosome PriB/single-strand DNA-binding (.1)
Potri.001G394200 50 / 3e-07 AT4G20010 269 / 7e-88 ORGANELLAR SINGLE-STRANDED DNA BINDING PROTEIN 2, plastid transcriptionally active 9 (.1.2)
Potri.014G035600 49 / 7e-07 AT1G47720 158 / 6e-46 Organellar Single-stranded, Primosome PriB/single-strand DNA-binding (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF00436 SSB Single-strand binding protein family
Representative CDS sequence
>Lus10002722 pacid=23158714 polypeptide=Lus10002722 locus=Lus10002722.g ID=Lus10002722.BGIv1.0 annot-version=v1.0
ATGGCGTTGGAGCGGCTGGCGCTGTCGAGTAAACTCTATTTCTGCGTGCCGAGTAACCCTAAGGCGAGCGGAAGTTCGCCTGGTTCGTCGTTGTTAACTT
CTAGCTGGTCAAGCTTCGAACCGCTGAGATTGAACCGCAGATTGAAGTGTTCGGCTGATTACAGAGACTACAACCAGAACAGTCAGACGGCAGTGGTTGG
ATACGAAATACCAGCTGAGATTCCGTGGAAGAAGGAGCTCTGCAACTCGGTGCAGCTCATCGGAAATGTTGGAAGTCCGGTCGAGATTAAACACTTCCCT
TCCGGGAAGGTCGTGGCGTGGACGAGTCTCGCGTTCAAGAAGTCCGCCACCGAATCTTGCTGGATCAATCTGACGTTCTGGAATGAAATGGCGGAAATCG
CCTCTGAACATGTACAGAAAGGTAACCAGATTTATATGTCCGGTCGATTGATTGTGGACACCGTTGAGAATGAAGAAGGAAAGATCCAGACGTACTACAA
GAGAAACCCAAAGTACCCAGATTTCAAGCACAAGGATACAGGAGAATCACTGTGGGTGGAAGGCAGGTATAATCCATCGTGGGTGAAGTCTCAGTTGTCG
ATCTTGGATGAACGTATGGGATATGTTCAGGACGATCATGATACTCGCGGTGAAGATATCTGTCAAATGGGTACTGACGAATTCTTGTCATTCTAA
AA sequence
>Lus10002722 pacid=23158714 polypeptide=Lus10002722 locus=Lus10002722.g ID=Lus10002722.BGIv1.0 annot-version=v1.0
MALERLALSSKLYFCVPSNPKASGSSPGSSLLTSSWSSFEPLRLNRRLKCSADYRDYNQNSQTAVVGYEIPAEIPWKKELCNSVQLIGNVGSPVEIKHFP
SGKVVAWTSLAFKKSATESCWINLTFWNEMAEIASEHVQKGNQIYMSGRLIVDTVENEEGKIQTYYKRNPKYPDFKHKDTGESLWVEGRYNPSWVKSQLS
ILDERMGYVQDDHDTRGEDICQMGTDEFLSF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G44785 OSB3 organellar single-stranded DNA... Lus10002722 0 1
AT5G54630 C2H2ZnF zinc finger protein-related (.... Lus10018388 3.9 0.8563
Lus10039807 4.0 0.8426
Lus10040269 4.2 0.8456
AT5G59320 LTP3 lipid transfer protein 3 (.1) Lus10025231 6.9 0.8250
AT4G24270 EMB140 EMBRYO DEFECTIVE 140 (.1.2) Lus10016122 7.4 0.8351
AT1G69710 Regulator of chromosome conden... Lus10037192 8.9 0.8489
AT2G21200 SAUR-like auxin-responsive pro... Lus10008992 11.8 0.8199
AT4G38840 SAUR-like auxin-responsive pro... Lus10008995 14.3 0.8111
Lus10023200 16.9 0.7602
AT5G43270 SBP SPL2 squamosa promoter binding prot... Lus10006411 17.5 0.8156

Lus10002722 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.