Lus10002723 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G43700 222 / 3e-74 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
AT1G04240 219 / 4e-73 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1)
AT3G23030 192 / 9e-63 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1)
AT4G14560 187 / 1e-60 AUX_IAA AXR5, IAA1 AUXIN RESISTANT 5, indole-3-acetic acid inducible (.1)
AT1G04250 181 / 2e-57 AUX_IAA IAA17, AXR3 indole-3-acetic acid inducible 17, AUXIN RESISTANT 3, AUX/IAA transcriptional regulator family protein (.1)
AT3G04730 171 / 1e-53 AUX_IAA IAA16 indoleacetic acid-induced protein 16 (.1)
AT3G23050 167 / 7e-52 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2)
AT4G14550 161 / 7e-50 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1)
AT4G29080 157 / 2e-47 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1)
AT3G15540 152 / 1e-46 AUX_IAA MSG2, IAA19 MASSUGU 2, indole-3-acetic acid inducible 19 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014729 380 / 3e-136 AT1G04240 230 / 2e-77 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1)
Lus10024853 277 / 2e-95 AT1G04240 216 / 1e-71 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1)
Lus10018764 274 / 4e-94 AT5G43700 210 / 4e-69 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Lus10039413 223 / 1e-74 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1)
Lus10039488 222 / 4e-74 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Lus10028222 177 / 2e-55 AT5G65670 322 / 3e-110 indole-3-acetic acid inducible 9 (.1.2)
Lus10039414 166 / 4e-51 AT4G14550 305 / 1e-105 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1)
Lus10042929 160 / 1e-47 AT5G65670 356 / 3e-122 indole-3-acetic acid inducible 9 (.1.2)
Lus10019241 156 / 6e-47 AT5G65670 356 / 4e-123 indole-3-acetic acid inducible 9 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G218200 248 / 2e-84 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Potri.005G053800 241 / 2e-81 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Potri.002G045000 240 / 4e-81 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Potri.013G041300 236 / 2e-79 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Potri.010G078400 219 / 7e-73 AT5G43700 248 / 9e-85 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Potri.008G161100 209 / 1e-68 AT5G43700 238 / 3e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1)
Potri.013G041400 171 / 3e-53 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1)
Potri.008G161200 169 / 1e-52 AT4G14550 343 / 1e-120 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1)
Potri.002G044900 165 / 3e-51 AT4G14550 286 / 1e-98 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1)
Potri.001G177400 162 / 5e-50 AT3G04730 211 / 8e-69 indoleacetic acid-induced protein 16 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF02309 AUX_IAA AUX/IAA family
Representative CDS sequence
>Lus10002723 pacid=23158710 polypeptide=Lus10002723 locus=Lus10002723.g ID=Lus10002723.BGIv1.0 annot-version=v1.0
ATGGAGAGCCGATCATCCCCTATGCAGTTGGACTCCGATCTGAATCTCAAAGCTACAGAGCTCAGACTAGGCTTGCCGGGAAGCGACGAGCCAAGCACCA
CTTCTCCATCTTCAACTCTACTTCAAATCAGCATCAATAATAACAACAAGAGATCTTCGCCGGAAGCATCCTCCATCGACGAGAGCAGGTCGCAGAGCAA
TTCCACCGCCTCCAACGTTGACCGAGATTCTATCCCCCCTCCCGCCAAAGCACAAGTAGTCGGATGGCCGCCGGTCCGTTCGTACAGGAAGAGCTGCTTA
CAGCAGAATAAAAACGAGCCGGGGATGTTTGTGAAAGTAAGCATGGACGGAGCTGCGTATCTCCGGAAGATCGACGTGAAGATGTACAAGAGCTACGAAG
AGCTTTTGACCGGGTTGGAGGAGATGTTCAAGCTGAGATTCGGTCAGTATTCGGAAAGAGAAGGATACAACGGATCTGATTTTGCTCCGACTTACCAAGA
CAAAGACGGTGATTGGATGCTGGTCGGCGATGTTCCGTGGGAGATGTTCATCAACTCTTGCAAAAGGCTTAGGATAATCAAAGGATCCGACGCCAGAGGG
CTTGGCTATTTATGA
AA sequence
>Lus10002723 pacid=23158710 polypeptide=Lus10002723 locus=Lus10002723.g ID=Lus10002723.BGIv1.0 annot-version=v1.0
MESRSSPMQLDSDLNLKATELRLGLPGSDEPSTTSPSSTLLQISINNNNKRSSPEASSIDESRSQSNSTASNVDRDSIPPPAKAQVVGWPPVRSYRKSCL
QQNKNEPGMFVKVSMDGAAYLRKIDVKMYKSYEELLTGLEEMFKLRFGQYSEREGYNGSDFAPTYQDKDGDWMLVGDVPWEMFINSCKRLRIIKGSDARG
LGYL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G43700 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible... Lus10002723 0 1
AT3G04730 AUX_IAA IAA16 indoleacetic acid-induced prot... Lus10006585 1.7 0.8816
AT1G04240 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-ac... Lus10014729 5.5 0.8488
AT5G24930 CO COL4, ATCOL4 CONSTANS-like 4 (.1) Lus10026909 7.1 0.8574
AT5G46110 TPT, APE2 triose-phosphate ⁄ phosp... Lus10013978 11.3 0.8647
AT1G67050 unknown protein Lus10009160 12.5 0.8327
AT1G67050 unknown protein Lus10028485 14.2 0.8134
AT5G67210 IRX15-L IRX15-LIKE, Protein of unknown... Lus10027879 16.7 0.8400
AT1G32860 Glycosyl hydrolase superfamily... Lus10017344 19.0 0.8247
AT1G15820 CP24, LHCB6 light harvesting complex photo... Lus10020417 19.5 0.8546
AT5G17820 Peroxidase superfamily protein... Lus10001324 22.3 0.8448

Lus10002723 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.