Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT3G46860 62 / 2e-14 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT5G43570 61 / 6e-14 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT5G43580 60 / 1e-13 UPI UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT2G38900 59 / 3e-13 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014740 [exp] 105 / 5e-32 AT2G38870 77 / 2e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018786 [exp] 91 / 4e-26 AT2G38870 93 / 6e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10024870 [exp] 88 / 8e-25 AT2G38870 94 / 2e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018783 [exp] 81 / 5e-22 AT2G38870 89 / 2e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018784 [exp] 76 / 3e-20 AT2G38870 89 / 1e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10032655 [exp] 62 / 4e-13 AT1G52870 499 / 3e-176 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10043097 [exp] 61 / 1e-12 AT1G52870 505 / 2e-179 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10024370 [exp] 45 / 2e-07 AT2G38870 47 / 3e-08 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10035626 [exp] 44 / 3e-07 AT2G38900 43 / 8e-07 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G075600 [exp] 87 / 1e-24 AT5G43580 80 / 3e-21 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075400 [exp] 86 / 3e-24 AT2G38870 84 / 3e-23 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.002G042300 [exp] 85 / 1e-23 AT2G38870 68 / 5e-17 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075200 [exp] 83 / 7e-23 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.011G110400 [exp] 80 / 1e-21 AT5G43580 78 / 1e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075800 [exp] 79 / 2e-21 AT2G38870 76 / 3e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.011G110100 [exp] 79 / 2e-21 AT5G43580 78 / 1e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.009G028300 [exp] 77 / 1e-20 AT5G43580 76 / 7e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075300 [exp] 77 / 2e-20 AT5G43580 77 / 2e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075501 [exp] 77 / 2e-20 AT5G43580 77 / 2e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0367 [flax] [poplar] CI-2 PF00280 [flax] [poplar] potato_inhibit Potato inhibitor I family
Representative CDS sequence Show only first row Show all	>Lus10002732 pacid=23158707 polypeptide=Lus10002732 locus=Lus10002732.g ID=Lus10002732.BGIv1.0 annot-version=v1.0 ATGTCGACTCACCGCTGTCGAGGTAAGACTTCGTGGCCGGAGCTGGTGGGGAAGAATGGACATACGGCGGCGGCGACGATTGAGAGGGAGAACAGAAATG TGCACGCGAAAATCATTAAGGAAGGAGATCCGATGACTATGGACTTTAGGTGCGATAGGGTTTTGGTTGTGGTTAATGAGCATGGCATAGTCACTTCCGT TCCTCGTACCTTTTGA
AA sequence Show only first row Show all	>Lus10002732 pacid=23158707 polypeptide=Lus10002732 locus=Lus10002732.g ID=Lus10002732.BGIv1.0 annot-version=v1.0 MSTHRCRGKTSWPELVGKNGHTAAATIERENRNVHAKIIKEGDPMTMDFRCDRVLVVVNEHGIVTSVPRTF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38870			Serine protease inhibitor, pot...		Lus10002732 [exp]	0	1

Compare expression of checked genes

Lus10002732 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.