Lus10002738 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G47960 68 / 4e-14 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
AT5G64620 47 / 2e-06 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
AT5G46930 44 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT3G17220 43 / 3e-05 ATPMEI2 pectin methylesterase inhibitor 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016317 154 / 6e-48 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10027947 92 / 1e-23 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 91 / 4e-23 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 90 / 1e-22 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017013 74 / 1e-16 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10037792 72 / 5e-16 AT1G47960 91 / 1e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017040 72 / 6e-16 AT1G47960 92 / 3e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10017076 72 / 1e-15 AT1G47960 88 / 9e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10037793 58 / 3e-10 AT3G17152 74 / 5e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G063000 78 / 4e-18 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.009G083500 70 / 5e-15 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.008G102600 52 / 1e-08 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.007G108301 51 / 4e-08 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
Potri.010G209800 43 / 2e-05 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10002738 pacid=23162036 polypeptide=Lus10002738 locus=Lus10002738.g ID=Lus10002738.BGIv1.0 annot-version=v1.0
ATGGCGCCAAATCCCACTCCCCCACCTCTCACAAACCTCGCCAATCTCGCCGCCTTTTTCCTCCTCCTCCTCAGTTCCGGCGTCGACGCTTCTCTAATCG
CCGACACCTGCAAGCAAACCCCGAACTACGACCTCTGCCTATCCTCAATCGCCGCAGACCCACGCGGCTCCAAAGCCGCCGACGTCGAAACACTCGCCCT
CGTGATGATCGACGCCGTCAAGTCGAAGGCGACGGCGGCGTCCAATCGCATACAGCAGCTGATGAAAACGGCGCCCACATCGATGCGGAAGCCTCTCAGA
GCCTGCGCCGAGGGTTACGACATCATAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGGGTGCGC
AGGGTGGGGCCGCCGTGACGGCGGCGATCATAAGGCTGTTGCTTTGATAGTTGATTAA
AA sequence
>Lus10002738 pacid=23162036 polypeptide=Lus10002738 locus=Lus10002738.g ID=Lus10002738.BGIv1.0 annot-version=v1.0
MAPNPTPPPLTNLANLAAFFLLLLSSGVDASLIADTCKQTPNYDLCLSSIAADPRGSKAADVETLALVMIDAVKSKATAASNRIQQLMKTAPTSMRKPLR
ACAEGYDIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGCAGWGRRDGGDHKAVALIVD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10002738 0 1
AT1G47960 ATC/VIF1, C/VIF... cell wall / vacuolar inhibitor... Lus10016317 1.4 0.9055
AT1G44170 ALDH4, ALDH3H1 aldehyde dehydrogenase 4, alde... Lus10018153 1.4 0.8445
AT2G02230 ATPP2-B1 phloem protein 2-B1 (.1) Lus10042713 2.6 0.8182
AT4G37420 Domain of unknown function (DU... Lus10016022 3.2 0.8210
AT4G31500 SUR2, RNT1, RED... SUPERROOT 2, RUNT 1, RED ELONG... Lus10012399 6.3 0.7906
AT4G40060 HD ATHB16 ,ATHB-16 homeobox protein 16 (.1) Lus10012753 7.2 0.7889
AT4G17250 unknown protein Lus10008508 8.2 0.8251
AT4G23630 RTNLB1, BTI1 Reticulan like protein B1, VIR... Lus10014948 8.5 0.8122
AT3G06240 F-box family protein (.1) Lus10026587 9.8 0.7667
AT4G24050 NAD(P)-binding Rossmann-fold s... Lus10003204 10.6 0.7278

Lus10002738 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.