Lus10002739 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G17130 122 / 3e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT1G47960 46 / 3e-06 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016319 233 / 8e-79 AT3G17130 151 / 8e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10037791 169 / 1e-53 AT3G17130 131 / 8e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10017074 156 / 2e-48 AT3G17130 121 / 8e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10002933 56 / 5e-10 AT1G47960 89 / 3e-22 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10003530 55 / 2e-09 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016317 53 / 1e-08 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10027947 50 / 1e-07 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10000822 46 / 3e-06 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Lus10016318 45 / 5e-06 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G102600 142 / 2e-43 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Potri.009G083500 64 / 6e-13 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
Potri.010G063000 61 / 1e-11 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10002739 pacid=23162041 polypeptide=Lus10002739 locus=Lus10002739.g ID=Lus10002739.BGIv1.0 annot-version=v1.0
ATGAGAATAATCTCCTCAATTCATCCTCTCCTCCTTCTAATCCTAATCCTCCTCCCATCCGCCGTCAAATCCGACGACCTAATCGAACAAGTCTGCAAAA
AAACCCCCTTCTACGGCCTCTGCGCCGCCACTCTCCACTCCAACTCCTCCTCCTCTGCATCCTCCGACATCAAGAGCCTCGCCTCGTCAGCAACCAACCT
TGTACTCTCCAACGCAACGGAAACACTGTCCTACATCCAGCAGCAGTTAAAGCAAACCAGAGATCCCAAGCTGGAGAAAGCTCTGGCCAACTGCGCCGAG
CTCTACATTCCGGTGGTGAAGTACAATCTCCCCCAGGCAATGGACGCTTTCCTCAGGGGGTATTACGGGTTTACCAAGTACGCGCTCTCCGACGCGAGTA
AGCAGGCTGATGCTTGCCAGAAGAGCTTGTCCGGCGCCGGGGCTTCCGGCGCGGGAGGGGAGTTGGGGGCGAGGAATAAGTTGTTGAGTGATTTGTGTGA
TGTAGGGGCCGCCATTGTTGGGTTGCTAATGAAAGTTGGGGGTTTGAAGGTTTGA
AA sequence
>Lus10002739 pacid=23162041 polypeptide=Lus10002739 locus=Lus10002739.g ID=Lus10002739.BGIv1.0 annot-version=v1.0
MRIISSIHPLLLLILILLPSAVKSDDLIEQVCKKTPFYGLCAATLHSNSSSSASSDIKSLASSATNLVLSNATETLSYIQQQLKQTRDPKLEKALANCAE
LYIPVVKYNLPQAMDAFLRGYYGFTKYALSDASKQADACQKSLSGAGASGAGGELGARNKLLSDLCDVGAAIVGLLMKVGGLKV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G17130 Plant invertase/pectin methyle... Lus10002739 0 1
AT3G17130 Plant invertase/pectin methyle... Lus10016319 1.0 0.9612
AT2G40940 ERS1 ethylene response sensor 1 (.1... Lus10013415 1.4 0.8851
AT3G55605 Mitochondrial glycoprotein fam... Lus10001015 5.3 0.8544
AT5G09590 HSC70-5, mtHSC7... HEAT SHOCK COGNATE, mitochondr... Lus10009677 7.7 0.8773
AT5G25190 AP2_ERF ESE3 ethylene and salt inducible 3,... Lus10035859 7.7 0.8273
AT4G09670 Oxidoreductase family protein ... Lus10013633 8.5 0.8665
AT5G57500 Galactosyltransferase family p... Lus10015527 17.9 0.7719
AT2G21060 ATCSP4, ATGRP2B COLD SHOCK DOMAIN PROTEIN 4, g... Lus10027839 18.2 0.8395
AT5G09590 HSC70-5, mtHSC7... HEAT SHOCK COGNATE, mitochondr... Lus10009039 18.6 0.8596
AT3G08590 iPGAM2 2,3-biphosphoglycerate-indepen... Lus10031877 19.4 0.8498

Lus10002739 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.