Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48485 57 / 9e-12 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G48490 55 / 3e-11 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55460 39 / 0.0001 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G55450 38 / 0.0002 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016323 [exp] 135 / 1e-42 AT5G48490 74 / 1e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10039511 [exp] 85 / 5e-23 AT5G48485 80 / 4e-21 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10038233 [exp] 66 / 5e-15 AT5G48490 78 / 5e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10025866 [exp] 65 / 6e-15 AT5G48490 79 / 3e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10016582 [exp] 45 / 2e-07 AT5G55410 81 / 2e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Lus10032575 [exp] 40 / 2e-05 AT5G55410 73 / 2e-18 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G149900 [exp] 85 / 1e-22 AT5G48485 77 / 1e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.002G251000 [exp] 66 / 3e-15 AT5G48485 76 / 2e-19 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.009G112553 [exp] 39 / 9e-05 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.T125404 [exp] 39 / 0.0001 AT5G48485 62 / 1e-13 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002741 pacid=23162058 polypeptide=Lus10002741 locus=Lus10002741.g ID=Lus10002741.BGIv1.0 annot-version=v1.0 ATGGCCAGAGTTGAAGTTGTAAGGATGATGGTGTTATGGGTGGTGGTAGTGTTGTTGTGTGTGGTGCAAGAAAGCAGTGGCCAGACGATATGCAACATAC CGATAGCGGGGTTACGAGCTTGCAAGCCATCGGTGACTCCCCCGAGGCCACCGATGCCTACTGCGGACTGCTGTCGAGCCATCTCGCATGCCGACATGAA ATGCATTTGCTCCTACAAGAACTCTCCTTTGCTCCCTTCCCTTGGCATCAGTGTCCCTCTTGCTCAGCAGCTCCCTGTCAAGTGCAGGCTCTCCACTGCT GCCAAATGCTAG
AA sequence Show only first row Show all	>Lus10002741 pacid=23162058 polypeptide=Lus10002741 locus=Lus10002741.g ID=Lus10002741.BGIv1.0 annot-version=v1.0 MARVEVVRMMVLWVVVVLLCVVQESSGQTICNIPIAGLRACKPSVTPPRPPMPTADCCRAISHADMKCICSYKNSPLLPSLGISVPLAQQLPVKCRLSTA AKC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48490			Bifunctional inhibitor/lipid-t...		Lus10002741 [exp]	0	1
AT3G54420		ATCHITIV, CHIV,...	CHITINASE CLASS IV, homolog of...		Lus10000453 [exp]	4.0	0.8348
AT5G48380		BIR1	BAK1-interacting receptor-like...		Lus10002147 [exp]	4.5	0.7996
AT5G48490			Bifunctional inhibitor/lipid-t...		Lus10016323 [exp]	4.7	0.8347
AT1G07890		ATAPX01, CS1, A...	maternal effect embryo arrest ...		Lus10015970 [exp]	8.3	0.8108
AT4G21700			Protein of unknown function (D...		Lus10030937 [exp]	8.9	0.7659
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Lus10017693 [exp]	13.9	0.7590
AT2G31880		SOBIR1, EVR	SUPPRESSOR OF BIR1 1, EVERSHED...		Lus10013675 [exp]	14.4	0.7523
AT2G16890			UDP-Glycosyltransferase superf...		Lus10022221 [exp]	15.9	0.7588
AT5G23530		ATCXE18	carboxyesterase 18 (.1)		Lus10029542 [exp]	16.5	0.7236
AT3G61220		SDR1	short-chain dehydrogenase/redu...		Lus10014689 [exp]	23.2	0.7489

Compare expression of checked genes

Lus10002741 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.