Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) AT3G26880 55 / 7e-11 Plant self-incompatibility protein S1 family (.1) AT1G11765 50 / 5e-09 Plant self-incompatibility protein S1 family (.1) AT5G04347 48 / 5e-08 Plant self-incompatibility protein S1 family (.1) AT2G06090 47 / 7e-08 Plant self-incompatibility protein S1 family (.1) AT4G29035 44 / 2e-06 Plant self-incompatibility protein S1 family (.1) AT4G16195 44 / 2e-06 Plant self-incompatibility protein S1 family (.1) AT5G12070 43 / 3e-06 Plant self-incompatibility protein S1 family (.1) AT3G10460 42 / 6e-06 Plant self-incompatibility protein S1 family (.1) AT5G12060 40 / 4e-05 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016329 [exp] 141 / 1e-44 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10016330 [exp] 120 / 2e-36 AT1G11765 47 / 2e-07 Plant self-incompatibility protein S1 family (.1) Lus10023195 [exp] 90 / 2e-24 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) Lus10002219 [exp] 87 / 1e-23 AT1G04645 40 / 2e-05 Plant self-incompatibility protein S1 family (.1) Lus10018785 [exp] 86 / 6e-23 AT4G16295 50 / 1e-08 S-protein homologue 1 (.1) Lus10023194 [exp] 86 / 9e-23 AT2G06090 49 / 3e-08 Plant self-incompatibility protein S1 family (.1) Lus10023196 [exp] 86 / 1e-22 AT2G06090 54 / 4e-10 Plant self-incompatibility protein S1 family (.1) Lus10019767 [exp] 82 / 4e-21 AT4G29035 50 / 1e-08 Plant self-incompatibility protein S1 family (.1) Lus10023085 [exp] 80 / 2e-20 AT5G12060 53 / 1e-09 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G066900 [exp] 62 / 3e-13 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.006G170200 [exp] 53 / 9e-10 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 52 / 2e-09 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.010G008300 [exp] 51 / 2e-09 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.004G199700 [exp] 49 / 2e-08 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.018G148366 [exp] 41 / 2e-05 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1) Potri.001G053300 [exp] 40 / 3e-05 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1) Potri.018G148630 [exp] 40 / 6e-05 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.015G130300 [exp] 39 / 0.0001 AT3G17080 52 / 3e-09 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 38 / 0.0003 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10002747 pacid=23162063 polypeptide=Lus10002747 locus=Lus10002747.g ID=Lus10002747.BGIv1.0 annot-version=v1.0 ATGGTTGCAGGCCCGTCGGCTGAGGACCAAGAGAGTGTCACTGTCGCCAATCAGATAAGTAAGGCCCTAATAGCGCATTGCCGATCAAAAGACACTGACC TCGGCGCGAACGTGGTTTCGATTGGCTCGGATTTGGCCTGGAGTTTCTACGACGATGTATTTTTCGGTACGACGCTTTTCTGGTGCCACCTGGCAGTGGG GGATAAGCGTCTTCATTTCACTGCGTACGAGGACGAGGGGAGATATCCAGGCACGACTCGTTGGGTGGTCAACGATACTGGAGTTTATTTGCCCGAGGAG CAATGCGCGTACCTATGGTAA
AA sequence Show only first row Show all	>Lus10002747 pacid=23162063 polypeptide=Lus10002747 locus=Lus10002747.g ID=Lus10002747.BGIv1.0 annot-version=v1.0 MVAGPSAEDQESVTVANQISKALIAHCRSKDTDLGANVVSIGSDLAWSFYDDVFFGTTLFWCHLAVGDKRLHFTAYEDEGRYPGTTRWVVNDTGVYLPEE QCAYLW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G04350			Plant self-incompatibility pro...		Lus10002747 [exp]	0	1
AT3G10340		PAL4	phenylalanine ammonia-lyase 4 ...		Lus10001405 [exp]	2.4	1.0000
					Lus10000363 [exp]	3.2	1.0000
					Lus10025781 [exp]	3.9	1.0000
AT1G61330			FBD, F-box and Leucine Rich Re...		Lus10006726 [exp]	4.6	1.0000
					Lus10003285 [exp]	5.5	1.0000
AT4G22285			Ubiquitin C-terminal hydrolase...		Lus10027745 [exp]	6.5	1.0000
					Lus10004996 [exp]	7.2	1.0000
AT2G25737			Sulfite exporter TauE/SafE fam...		Lus10022134 [exp]	9.4	1.0000
AT5G12060			Plant self-incompatibility pro...		Lus10022829 [exp]	9.5	1.0000
					Lus10000977 [exp]	10.0	1.0000

Compare expression of checked genes

Lus10002747 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.