Lus10002752 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G11010 79 / 2e-16 AtRLP34 receptor like protein 34 (.1)
AT2G34930 76 / 2e-15 disease resistance family protein / LRR family protein (.1)
AT3G47570 74 / 1e-14 Leucine-rich repeat protein kinase family protein (.1)
AT3G05660 73 / 2e-14 AtRLP33 receptor like protein 33 (.1)
AT5G44700 73 / 3e-14 GSO2, EDA23 GASSHO 2, EMBRYO SAC DEVELOPMENT ARREST 23, Leucine-rich repeat transmembrane protein kinase (.1)
AT1G74180 71 / 1e-13 AtRLP14 receptor like protein 14 (.1)
AT1G71400 71 / 2e-13 AtRLP12 receptor like protein 12 (.1)
AT1G58190 70 / 3e-13 AtRLP9 receptor like protein 9 (.1.2)
AT3G28890 70 / 3e-13 AtRLP43 receptor like protein 43 (.1.2)
AT4G20140 68 / 2e-12 GSO1 GASSHO1, Leucine-rich repeat transmembrane protein kinase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002755 213 / 7e-63 AT2G34930 467 / 2e-149 disease resistance family protein / LRR family protein (.1)
Lus10016339 212 / 2e-62 AT2G34930 495 / 2e-160 disease resistance family protein / LRR family protein (.1)
Lus10016341 210 / 6e-62 AT2G34930 482 / 3e-155 disease resistance family protein / LRR family protein (.1)
Lus10016340 204 / 8e-60 AT2G34930 492 / 8e-159 disease resistance family protein / LRR family protein (.1)
Lus10001035 199 / 6e-58 AT2G34930 488 / 9e-157 disease resistance family protein / LRR family protein (.1)
Lus10001034 184 / 5e-53 AT2G34930 360 / 1e-110 disease resistance family protein / LRR family protein (.1)
Lus10000220 178 / 9e-52 AT2G34930 312 / 1e-95 disease resistance family protein / LRR family protein (.1)
Lus10000236 177 / 3e-51 AT2G34930 328 / 2e-101 disease resistance family protein / LRR family protein (.1)
Lus10016344 177 / 3e-50 AT2G34930 399 / 1e-124 disease resistance family protein / LRR family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G262800 103 / 1e-24 AT2G34930 429 / 8e-135 disease resistance family protein / LRR family protein (.1)
Potri.010G106900 93 / 4e-21 AT2G34930 506 / 1e-164 disease resistance family protein / LRR family protein (.1)
Potri.010G107000 92 / 8e-21 AT2G34930 504 / 1e-163 disease resistance family protein / LRR family protein (.1)
Potri.012G034600 87 / 5e-19 AT2G34930 434 / 1e-137 disease resistance family protein / LRR family protein (.1)
Potri.015G025200 82 / 2e-17 AT2G34930 414 / 7e-130 disease resistance family protein / LRR family protein (.1)
Potri.015G025800 82 / 3e-17 AT2G34930 375 / 3e-115 disease resistance family protein / LRR family protein (.1)
Potri.003G196766 81 / 5e-17 AT2G34930 257 / 7e-76 disease resistance family protein / LRR family protein (.1)
Potri.015G024600 78 / 4e-16 AT2G34930 415 / 5e-130 disease resistance family protein / LRR family protein (.1)
Potri.015G028600 78 / 5e-16 AT2G34930 387 / 1e-119 disease resistance family protein / LRR family protein (.1)
Potri.015G025300 77 / 2e-15 AT2G34930 314 / 1e-91 disease resistance family protein / LRR family protein (.1)
PFAM info
Representative CDS sequence
>Lus10002752 pacid=23162048 polypeptide=Lus10002752 locus=Lus10002752.g ID=Lus10002752.BGIv1.0 annot-version=v1.0
ATGGGTTTTTCTTCTTGGGTTAATGGCAGCACGGATTGCTGCAAATGGCCTGGTGTTGTATGTGGCGGCAAAGTTACTGGCCACGTCACGCAGCTTCGCC
TCCAGTGTCCTGGTCTTTGTTCCCAGAAATCTAAGCTCAAGGAACTTGGTATCAGAGCTAGTAGAGATGACTATGTGCTATATGCTGATAGTTTGCAGTG
GCTTTCTGGTATGTCTGCACTGGAATACCTTGCTCTAAGTGGTGTTAATCTTACATTTGAAGGAGGGGATGCCAGCGTCATTCAGAAGCTTTTGCCAGTT
GGCCTCACTGAAACTTTGACTGATCAGATTGGCAAGTCCAAGAGGCTAAACCATCTTGCTCTCGATGACAACTCCATATCTGGTCCACTCCCGATGTCAT
TTGGGGAACTGACATCATTGTATTATGTCAACCTTGCAACTGACCAGATTAATGGGACTATTCCAACAAGTTTTGGGAGACTTGAAGAGCTTGAAATTGT
TGACATTTCTCATAACTTAATGGAAGGTATTGTTTTGTCCGAAATTCACTTTGCTAATCTCACAAGCTTGTTTAGATTCGAAGCAGCTGGAAACCAAATT
GTGTTCGAAGCTAAATCTGATTGGGTTCCTCCGAAGAAACTCACGATATTGGACTTGAGTTCATGGTACATTGGACCTGGCTTTCCGAAATGGCTCCTCC
AATCAAGTCAACATCTCAGATCACTGGGGCTCACGAGCAGTGTTCTCCTACCGCAATCTTTCTCACAATCAGATCTCAGGAATGCTTCCAAGTTATATCT
TTGTTATTCCCTCCGACTCTATGTTTGA
AA sequence
>Lus10002752 pacid=23162048 polypeptide=Lus10002752 locus=Lus10002752.g ID=Lus10002752.BGIv1.0 annot-version=v1.0
MGFSSWVNGSTDCCKWPGVVCGGKVTGHVTQLRLQCPGLCSQKSKLKELGIRASRDDYVLYADSLQWLSGMSALEYLALSGVNLTFEGGDASVIQKLLPV
GLTETLTDQIGKSKRLNHLALDDNSISGPLPMSFGELTSLYYVNLATDQINGTIPTSFGRLEELEIVDISHNLMEGIVLSEIHFANLTSLFRFEAAGNQI
VFEAKSDWVPPKKLTILDLSSWYIGPGFPKWLLQSSQHLRSLGLTSSVLLPQSFSQSDLRNASKLYLCYSLRLYV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G11010 AtRLP34 receptor like protein 34 (.1) Lus10002752 0 1
Lus10002077 3.5 0.5496
AT1G17930 Aminotransferase-like, plant m... Lus10004818 5.9 0.6225
AT5G35410 ATSOS2, CIPK24,... SNF1-RELATED PROTEIN KINASE 3.... Lus10043267 30.3 0.5492
AT3G49290 ABIL2 ABL interactor-like protein 2 ... Lus10032421 40.7 0.5319
AT3G50120 Plant protein of unknown funct... Lus10018320 54.6 0.5003
AT5G36930 Disease resistance protein (TI... Lus10008415 59.2 0.4806
AT4G04650 RNA-directed DNA polymerase (r... Lus10008147 66.5 0.5044
AT5G43370 PHT1;2, APT1, P... ARABIDOPSIS PHOSPHATE TRANSPOR... Lus10027631 77.8 0.4874
AT1G19835 Plant protein of unknown funct... Lus10033813 89.9 0.4587
AT3G22060 Receptor-like protein kinase-r... Lus10022286 91.7 0.4771

Lus10002752 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.