Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34930 103 / 1e-26 disease resistance family protein / LRR family protein (.1) AT3G28890 73 / 8e-16 AtRLP43 receptor like protein 43 (.1.2) AT2G26380 67 / 1e-13 Leucine-rich repeat (LRR) family protein (.1) AT1G33612 66 / 2e-13 Leucine-rich repeat (LRR) family protein (.1) AT1G33590 66 / 3e-13 Leucine-rich repeat (LRR) family protein (.1) AT3G05660 66 / 3e-13 AtRLP33 receptor like protein 33 (.1) AT3G23120 65 / 4e-13 AtRLP38 receptor like protein 38 (.1) AT1G33610 65 / 6e-13 Leucine-rich repeat (LRR) family protein (.1) AT3G11080 65 / 6e-13 AtRLP35 receptor like protein 35 (.1) AT5G27060 64 / 2e-12 AtRLP53 receptor like protein 53 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016342 [exp] 215 / 8e-66 AT2G34930 478 / 4e-154 disease resistance family protein / LRR family protein (.1) Lus10016338 [exp] 186 / 9e-56 AT2G34930 387 / 3e-121 disease resistance family protein / LRR family protein (.1) Lus10016344 [exp] 184 / 1e-54 AT2G34930 399 / 1e-124 disease resistance family protein / LRR family protein (.1) Lus10002758 [exp] 179 / 7e-53 AT2G34930 443 / 1e-140 disease resistance family protein / LRR family protein (.1) Lus10016340 [exp] 178 / 1e-52 AT2G34930 492 / 8e-159 disease resistance family protein / LRR family protein (.1) Lus10016337 [exp] 173 / 6e-51 AT2G34930 471 / 6e-151 disease resistance family protein / LRR family protein (.1) Lus10001035 [exp] 160 / 2e-46 AT2G34930 488 / 9e-157 disease resistance family protein / LRR family protein (.1) Lus10039523 [exp] 150 / 2e-46 AT2G34930 103 / 3e-25 disease resistance family protein / LRR family protein (.1) Lus10016341 [exp] 159 / 4e-46 AT2G34930 482 / 3e-155 disease resistance family protein / LRR family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G196832 [exp] 132 / 3e-37 AT2G34930 203 / 8e-57 disease resistance family protein / LRR family protein (.1) Potri.015G025300 [exp] 109 / 2e-28 AT2G34930 314 / 1e-91 disease resistance family protein / LRR family protein (.1) Potri.001G027500 [exp] 102 / 3e-27 AT2G34930 130 / 1e-33 disease resistance family protein / LRR family protein (.1) Potri.015G024600 [exp] 105 / 4e-27 AT2G34930 415 / 5e-130 disease resistance family protein / LRR family protein (.1) Potri.015G025200 [exp] 105 / 5e-27 AT2G34930 414 / 7e-130 disease resistance family protein / LRR family protein (.1) Potri.015G025800 [exp] 104 / 8e-27 AT2G34930 375 / 3e-115 disease resistance family protein / LRR family protein (.1) Potri.010G106900 [exp] 102 / 6e-26 AT2G34930 506 / 1e-164 disease resistance family protein / LRR family protein (.1) Potri.001G262800 [exp] 100 / 4e-25 AT2G34930 429 / 8e-135 disease resistance family protein / LRR family protein (.1) Potri.010G107000 [exp] 99 / 5e-25 AT2G34930 504 / 1e-163 disease resistance family protein / LRR family protein (.1) Potri.015G025100 [exp] 99 / 7e-25 AT2G34930 361 / 3e-109 disease resistance family protein / LRR family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08263 [flax] [poplar] LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence Show only first row Show all	>Lus10002757 pacid=23162064 polypeptide=Lus10002757 locus=Lus10002757.g ID=Lus10002757.BGIv1.0 annot-version=v1.0 ATGATCCACTGCTCCATCACTGTTTCTGCACTTCTTGTTTGGTTGAGTTGGATGTGTTACTGCCATGGGAGTTCAGGAGCTGGCTGCATCCTCGACGAGA GAGACGCCCTTTTAAGCATCAAAGCCGATCTCAAAGACCCTTCGAGCCGGCTATCTTCTTGGGAAAAGGGCAATGCAGATTGTTGCACATGGTCTGGTGT TGTTTGTGACAACATCACCGGTCATGTCACTCAGCTTCACCTCAGATGTCCTTACTATTGTTCAAGGGATTTGATGTTCACGGGTAAGATAAGTCCTTCC TTACTTGGGTTGAAGCATCTCAGTTATTTGGACCTGACAAGAAACGATTTCCGAGGAATCCCTATTCCGGAATTTCTCGGATCTATGAGCAGCTTGAAAT ATCTTTACCTTATTTGA
AA sequence Show only first row Show all	>Lus10002757 pacid=23162064 polypeptide=Lus10002757 locus=Lus10002757.g ID=Lus10002757.BGIv1.0 annot-version=v1.0 MIHCSITVSALLVWLSWMCYCHGSSGAGCILDERDALLSIKADLKDPSSRLSSWEKGNADCCTWSGVVCDNITGHVTQLHLRCPYYCSRDLMFTGKISPS LLGLKHLSYLDLTRNDFRGIPIPEFLGSMSSLKYLYLI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G34930			disease resistance family prot...		Lus10002757 [exp]	0	1
AT2G34930			disease resistance family prot...		Lus10002758 [exp]	1.4	0.8918
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10016893 [exp]	4.5	0.7506
AT2G26530		AR781	Protein of unknown function (D...		Lus10032766 [exp]	5.1	0.7993
AT1G68260			Thioesterase superfamily prote...		Lus10031936 [exp]	6.0	0.6683
AT2G34930			disease resistance family prot...		Lus10000236 [exp]	6.2	0.7674
AT1G09157			Protein of unknown function (D...		Lus10030466 [exp]	12.6	0.7455
AT1G60730			NAD(P)-linked oxidoreductase s...		Lus10037408 [exp]	16.1	0.6659
AT3G47570			Leucine-rich repeat protein ki...		Lus10009394 [exp]	18.2	0.6713
AT1G15520		ATABCG40, ABCG4...	Arabidopsis thaliana ATP-bindi...		Lus10041680 [exp]	25.9	0.6013
AT2G38470	WRKY	ATWRKY33, WRKY3...	WRKY DNA-binding protein 33 (....		Lus10026409 [exp]	26.6	0.7084

Compare expression of checked genes

Lus10002757 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.