Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18960 103 / 1e-28 MADS AG AGAMOUS, K-box region and MADS-box transcription factor family protein (.1.2) AT2G42830 102 / 2e-28 MADS AGL5, SHP2 SHATTERPROOF 2, AGAMOUS-like 5, K-box region and MADS-box transcription factor family protein (.1.2) AT3G58780 102 / 3e-28 MADS AGL1, SHP1 SHATTERPROOF 1, AGAMOUS-like 1, K-box region and MADS-box transcription factor family protein (.1.2.3) AT4G09960 101 / 3e-28 MADS AGL11, STK SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) AT4G11880 87 / 2e-22 MADS AGL14 AGAMOUS-like 14 (.1) AT1G24260 87 / 3e-22 MADS AGL9, SEP3 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) AT2G03710 85 / 3e-22 MADS AGL3, SEP4 SEPALLATA 4, AGAMOUS-like 3, K-box region and MADS-box transcription factor family protein (.1.2.3) AT5G15800 85 / 1e-21 MADS AGL2, SEP1 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) AT2G45650 85 / 2e-21 MADS AGL6 AGAMOUS-like 6 (.1) AT5G62165 84 / 2e-21 MADS FYF, AGL42 FOREVER YOUNG FLOWER, AGAMOUS-like 42 (.1.2.3.4.5)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029275 [exp] 124 / 9e-37 AT3G58780 220 / 2e-71 SHATTERPROOF 1, AGAMOUS-like 1, K-box region and MADS-box transcription factor family protein (.1.2.3) Lus10008264 [exp] 102 / 9e-28 AT4G09960 328 / 3e-114 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Lus10005302 [exp] 101 / 9e-28 AT4G09960 330 / 2e-115 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Lus10009481 [exp] 99 / 1e-26 AT4G09960 274 / 1e-92 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Lus10011349 [exp] 87 / 1e-23 AT5G15800 125 / 3e-37 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) Lus10036543 [exp] 85 / 3e-23 AT2G45660 120 / 6e-36 SUPPRESSOR OF OVEREXPRESSION OF CO 1, AGAMOUS-like 20 (.1) Lus10026678 [exp] 88 / 5e-23 AT5G15800 225 / 3e-74 SEPALLATA1, AGAMOUS-like 2, K-box region and MADS-box transcription factor family protein (.1.2) Lus10015765 [exp] 89 / 7e-23 AT1G24260 347 / 5e-122 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Lus10004638 [exp] 88 / 7e-23 AT3G02310 246 / 2e-82 SEPALLATA 2, AGAMOUS-like 4, K-box region and MADS-box transcription factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G077200 [exp] 104 / 2e-29 AT4G09960 274 / 5e-94 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Potri.011G075800 [exp] 104 / 4e-29 AT4G18960 325 / 2e-113 AGAMOUS, K-box region and MADS-box transcription factor family protein (.1.2) Potri.013G104900 [exp] 102 / 1e-28 AT4G09960 330 / 3e-116 SEEDSTICK, AGAMOUS-like 11, K-box region and MADS-box transcription factor family protein (.1.2.3.4) Potri.004G064300 [exp] 100 / 1e-27 AT4G18960 313 / 8e-109 AGAMOUS, K-box region and MADS-box transcription factor family protein (.1.2) Potri.001G112400 [exp] 87 / 1e-22 AT4G22950 253 / 6e-86 AGAMOUS-like 19 (.1) Potri.003G119700 [exp] 87 / 1e-22 AT4G11880 226 / 4e-75 AGAMOUS-like 14 (.1) Potri.014G074200 [exp] 87 / 2e-22 AT2G45660 242 / 3e-81 SUPPRESSOR OF OVEREXPRESSION OF CO 1, AGAMOUS-like 20 (.1) Potri.003G169600 [exp] 87 / 2e-22 AT1G24260 359 / 7e-127 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Potri.001G058400 [exp] 87 / 2e-22 AT1G24260 362 / 8e-128 SEPALLATA3, AGAMOUS-like 9, K-box region and MADS-box transcription factor family protein (.1.2.3) Potri.014G074100 [exp] 86 / 5e-22 AT2G45650 311 / 5e-108 AGAMOUS-like 6 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00319 [flax] [poplar] SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain)
Representative CDS sequence Show only first row Show all	>Lus10002763 pacid=23164118 polypeptide=Lus10002763 locus=Lus10002763.g ID=Lus10002763.BGIv1.0 annot-version=v1.0 ATGTCCGGCTACCAGAGCGATTCGAGGGAGGATTCGCCATCACAGAGGAAGATTGGGAGAGGGAAGATCGAGATCAAGAGGATCGAGAACACCACGAATC GGCAGGTGACCTTTTGCAAGAGGAGGAATGGCCTGCTGAAGAAGGCTTACGAATTGTCTGTGCTTTGTGATGCTGAGATTGCTCTTATTGTCTTCTCCAG CCGTGGCCGCCTCTATGAGTATGCTAACAACAGCTCTTCATTTCACCTCCAAATACTTATAGGAGGGATGGATCAGTTATGA
AA sequence Show only first row Show all	>Lus10002763 pacid=23164118 polypeptide=Lus10002763 locus=Lus10002763.g ID=Lus10002763.BGIv1.0 annot-version=v1.0 MSGYQSDSREDSPSQRKIGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSSRGRLYEYANNSSSFHLQILIGGMDQL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G18960	MADS	AG	AGAMOUS, K-box region and MADS...		Lus10002763 [exp]	0	1
AT2G30830			2-oxoglutarate (2OG) and Fe(II...		Lus10023600 [exp]	6.2	0.8903
AT3G58780	MADS	AGL1, SHP1	SHATTERPROOF 1, AGAMOUS-like 1...		Lus10029275 [exp]	7.5	0.9281
					Lus10016313 [exp]	9.4	0.7513
AT5G15800	MADS	AGL2, SEP1	SEPALLATA1, AGAMOUS-like 2, K-...		Lus10034663 [exp]	11.5	0.9052
					Lus10011636 [exp]	14.3	0.8992
AT3G16970			Plant self-incompatibility pro...		Lus10011753 [exp]	16.5	0.8992
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10011892 [exp]	18.4	0.8992
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10022473 [exp]	20.2	0.8992
AT4G10950			SGNH hydrolase-type esterase s...		Lus10023070 [exp]	21.8	0.8992
AT1G34575			FAD-binding Berberine family p...		Lus10023373 [exp]	23.3	0.8992

Compare expression of checked genes

Lus10002763 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.