Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029276 [exp] 94 / 9e-24 AT5G39050 314 / 1e-102 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G094700 [exp] 60 / 5e-12 AT5G39080 315 / 8e-103 HXXXD-type acyl-transferase family protein (.1) Potri.001G395900 [exp] 45 / 9e-07 AT5G39050 299 / 1e-96 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.001G455150 [exp] 45 / 9e-07 AT5G39050 191 / 7e-58 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.001G395700 [exp] 45 / 1e-06 AT5G39050 288 / 4e-92 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.010G208100 [exp] 40 / 6e-05 AT5G39050 332 / 3e-109 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G109800 [exp] 40 / 9e-05 AT5G39050 368 / 2e-123 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G110640 [exp] 39 / 0.0002 AT5G39050 365 / 2e-122 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G109300 [exp] 39 / 0.0002 AT5G39050 365 / 3e-122 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G110700 [exp] 38 / 0.0003 AT5G39050 369 / 1e-123 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1) Potri.004G110400 [exp] 38 / 0.0003 AT5G39050 363 / 2e-121 phenolic glucoside malonyltransferase 1, HXXXD-type acyl-transferase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002764 pacid=23164114 polypeptide=Lus10002764 locus=Lus10002764.g ID=Lus10002764.BGIv1.0 annot-version=v1.0 ATGGATTACTTGGTGGAGGAAGCTGGGAGGTTCATGGAGGAGGACGGCATAGCGGCGGTGGCGGAGAGGATTAGCGAATTGGTGAGGGTGGCGGCGGAGG TGGATTCGGAAGAGGAGGTGGAGAAGACGGCGAGGCTGAGGCGCGTGGGGCCCGAGGCGCAGGAGGTGGGGGTAGCTGGGTCCCATAGGTTGGGGTTATA TGACGTGGATTCGGATTGGGAAGCCGGTGAAGATGGAAACGACGTCGGTGGAGAAAACGCGGGGGATTTCGTTGACGGAGAGTAG
AA sequence Show only first row Show all	>Lus10002764 pacid=23164114 polypeptide=Lus10002764 locus=Lus10002764.g ID=Lus10002764.BGIv1.0 annot-version=v1.0 MDYLVEEAGRFMEEDGIAAVAERISELVRVAAEVDSEEEVEKTARLRRVGPEAQEVGVAGSHRLGLYDVDSDWEAGEDGNDVGGENAGDFVDGE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002764 [exp]	0	1
AT3G62150		ABCB21, PGP21	ATP-binding cassette B21, P-gl...		Lus10010068 [exp]	2.4	0.9450
AT1G01180			S-adenosyl-L-methionine-depend...		Lus10030709 [exp]	3.0	0.9617
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10036819 [exp]	5.7	0.9583
					Lus10002317 [exp]	6.0	0.9466
AT1G74920		ALDH10A8	aldehyde dehydrogenase 10A8 (....		Lus10004239 [exp]	7.4	0.9452
AT4G00050	bHLH	bHLH016, UNE10	unfertilized embryo sac 10, ba...		Lus10000208 [exp]	7.5	0.9456
AT4G00050	bHLH	bHLH016, UNE10	unfertilized embryo sac 10, ba...		Lus10015734 [exp]	9.9	0.9404
AT1G20050		HYD1	HYDRA1, C-8,7 sterol isomerase...		Lus10008164 [exp]	14.5	0.8614
					Lus10038295 [exp]	17.2	0.9338
AT2G38150			alpha 1,4-glycosyltransferase ...		Lus10027772 [exp]	17.2	0.9380

Compare expression of checked genes

Lus10002764 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.