Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G29640 87 / 4e-23 Protein of unknown function, DUF584 (.1) AT2G34340 83 / 2e-21 Protein of unknown function, DUF584 (.1) AT4G18980 69 / 3e-16 AtS40-3 AtS40-3 (.1) AT5G45630 67 / 1e-15 Protein of unknown function, DUF584 (.1) AT4G04630 62 / 6e-13 Protein of unknown function, DUF584 (.1) AT4G21970 61 / 7e-13 Protein of unknown function, DUF584 (.1) AT3G15040 56 / 3e-10 Protein of unknown function, DUF584 (.1) AT3G45210 53 / 1e-09 Protein of unknown function, DUF584 (.1) AT2G28400 49 / 3e-08 Protein of unknown function, DUF584 (.1) AT5G60680 47 / 2e-07 Protein of unknown function, DUF584 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011993 [exp] 159 / 6e-52 AT1G29640 105 / 4e-30 Protein of unknown function, DUF584 (.1) Lus10006781 [exp] 64 / 2e-13 AT4G21970 128 / 6e-38 Protein of unknown function, DUF584 (.1) Lus10020043 [exp] 63 / 3e-13 AT4G21970 127 / 1e-37 Protein of unknown function, DUF584 (.1) Lus10034190 [exp] 62 / 1e-12 AT3G15040 125 / 9e-36 Protein of unknown function, DUF584 (.1) Lus10021536 [exp] 60 / 5e-12 AT4G21970 102 / 1e-27 Protein of unknown function, DUF584 (.1) Lus10040067 [exp] 59 / 1e-11 AT4G21970 98 / 2e-25 Protein of unknown function, DUF584 (.1) Lus10021474 [exp] 54 / 8e-10 AT5G60680 138 / 6e-42 Protein of unknown function, DUF584 (.1) Lus10000724 [exp] 53 / 1e-09 AT3G45210 111 / 1e-31 Protein of unknown function, DUF584 (.1) Lus10004207 [exp] 54 / 2e-09 AT3G15040 110 / 1e-29 Protein of unknown function, DUF584 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G076900 [exp] 94 / 9e-26 AT1G29640 90 / 4e-24 Protein of unknown function, DUF584 (.1) Potri.004G014000 [exp] 65 / 6e-14 AT4G04630 124 / 4e-36 Protein of unknown function, DUF584 (.1) Potri.011G004100 [exp] 64 / 9e-14 AT4G04630 125 / 1e-36 Protein of unknown function, DUF584 (.1) Potri.016G076300 [exp] 59 / 1e-11 AT3G15040 90 / 9e-22 Protein of unknown function, DUF584 (.1) Potri.009G014100 [exp] 54 / 9e-10 AT3G45210 124 / 2e-36 Protein of unknown function, DUF584 (.1) Potri.004G211100 [exp] 53 / 2e-09 AT5G60680 120 / 1e-34 Protein of unknown function, DUF584 (.1) Potri.006G127900 [exp] 52 / 4e-09 AT5G03230 122 / 1e-35 Protein of unknown function, DUF584 (.1) Potri.016G089900 [exp] 51 / 6e-09 AT5G03230 115 / 6e-33 Protein of unknown function, DUF584 (.1) Potri.004G015700 [exp] 50 / 4e-08 AT1G11700 151 / 5e-46 Protein of unknown function, DUF584 (.1) Potri.011G003300 [exp] 46 / 1e-06 AT1G11700 161 / 6e-50 Protein of unknown function, DUF584 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04520 [flax] [poplar] Senescence_reg Senescence regulator
Representative CDS sequence Show only first row Show all	>Lus10002781 pacid=23164108 polypeptide=Lus10002781 locus=Lus10002781.g ID=Lus10002781.BGIv1.0 annot-version=v1.0 ATGGCGGCCGAAGAGCTCCGCGAATCCGAAATCATCTTCCCCTGCCGGGAAACGATGCCGGATCACCAACATCACAATGCTCACCGGTCGAAGAAGAAAA GGAAGCAGAAGAGTTCGGTCCCGGTGAACATACCGATGAATAATGTGTTCCGGTTCGGAGATTCCGAGGAGTTCGAGGAGGATTATGAAGATTCCGAAGA GCTGGTCCCTCCCCACGTGATACTCGGGAGGAGGGTGGCCGGAAAAATGGCGTTCTCCGTTTGTACGGGGAACGGAAGAACGTTAAAAGGAAGGGATTTG AGCCAAGTCAGGAACTCGATTCTTAGGATGACTGGCTTTTTAGAGACGTGA
AA sequence Show only first row Show all	>Lus10002781 pacid=23164108 polypeptide=Lus10002781 locus=Lus10002781.g ID=Lus10002781.BGIv1.0 annot-version=v1.0 MAAEELRESEIIFPCRETMPDHQHHNAHRSKKKRKQKSSVPVNIPMNNVFRFGDSEEFEEDYEDSEELVPPHVILGRRVAGKMAFSVCTGNGRTLKGRDL SQVRNSILRMTGFLET

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G29640			Protein of unknown function, D...		Lus10002781 [exp]	0	1
AT5G57655			xylose isomerase family protei...		Lus10001321 [exp]	5.7	0.9539
AT1G19530			unknown protein		Lus10002540 [exp]	9.9	0.9447
AT1G18270			ketose-bisphosphate aldolase c...		Lus10008753 [exp]	12.0	0.9383
AT4G32480			Protein of unknown function (D...		Lus10015437 [exp]	12.8	0.9425
AT4G34030		MCCB	3-methylcrotonyl-CoA carboxyla...		Lus10019848 [exp]	13.9	0.9415
AT4G09730		RH39	RH39 (.1)		Lus10018946 [exp]	16.1	0.9123
AT1G18270			ketose-bisphosphate aldolase c...		Lus10002140 [exp]	17.3	0.9315
AT5G24890			unknown protein		Lus10009793 [exp]	17.4	0.9380
AT5G57655			xylose isomerase family protei...		Lus10006983 [exp]	19.8	0.9382
AT4G33150		LKR/SDH, SDH	lysine-ketoglutarate reductase...		Lus10009808 [exp]	19.9	0.9411

Compare expression of checked genes

Lus10002781 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.