Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G14740 50 / 6e-09 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region AT3G22810 48 / 5e-08 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region (.1) AT5G43870 47 / 1e-07 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041187 [exp] 0 / 1 AT4G14740 315 / 1e-103 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G157000 [exp] 53 / 6e-10 AT3G22810 430 / 9e-148 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region (.1) Potri.002G049200 [exp] 47 / 9e-08 AT3G63300 418 / 1e-142 FORKED 1 (.1.2) Potri.010G082400 [exp] 46 / 2e-07 AT4G14740 468 / 1e-162 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region Potri.018G042000 [exp] 38 / 0.0001 AT4G32785 159 / 1e-47 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05703 [flax] [poplar] Auxin_canalis Auxin canalisation
Representative CDS sequence Show only first row Show all	>Lus10002798 pacid=23171443 polypeptide=Lus10002798 locus=Lus10002798.g ID=Lus10002798.BGIv1.0 annot-version=v1.0 ATGATCCTCGGTGGCGGCAGCGGGAAGACGGTTGGGAGGTGGTTAAAGGATGGGAAGGAGAAGAAGAAGGAAGAGACGAGGGCCCACAACTCACAGGTCC AGGCTGCGATCTCCGATGCCGGAGTCACCATCGCAATTGCGGCTATAGCAGCTGCCAAGAGGCTTCTTCTAGGTCTGCCGGTAGTAAGGATGAGCAGCAC GCCCGGACTGACATGGTGGTAG
AA sequence Show only first row Show all	>Lus10002798 pacid=23171443 polypeptide=Lus10002798 locus=Lus10002798.g ID=Lus10002798.BGIv1.0 annot-version=v1.0 MILGGGSGKTVGRWLKDGKEKKKEETRAHNSQVQAAISDAGVTIAIAAIAAAKRLLLGLPVVRMSSTPGLTWW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G14740			Plant protein of unknown funct...		Lus10002798 [exp]	0	1
AT1G13570			F-box/RNI-like superfamily pro...		Lus10011048 [exp]	3.6	0.9413
					Lus10021618 [exp]	4.8	0.8931
AT3G09870			SAUR-like auxin-responsive pro...		Lus10030263 [exp]	6.3	0.9410
AT1G72610		ATGER1, GLP1	A. THALIANA GERMIN-LIKE PROTEI...		Lus10002795 [exp]	6.5	0.9353
AT2G32720		B5 #4, B5#4, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10012615 [exp]	9.7	0.8790
AT2G32180		PTAC18	plastid transcriptionally acti...		Lus10035307 [exp]	10.0	0.8960
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10029575 [exp]	10.9	0.9238
AT1G14960			Polyketide cyclase/dehydrase a...		Lus10042489 [exp]	11.3	0.9329
AT2G02950		PKS1	phytochrome kinase substrate 1...		Lus10030480 [exp]	11.4	0.9317
AT4G17810	C2H2ZnF	ZFP12	C2H2 and C2HC zinc fingers sup...		Lus10040083 [exp]	13.0	0.9208

Compare expression of checked genes

Lus10002798 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.