Lus10002802 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026843 95 / 4e-24 ND /
Lus10003415 72 / 1e-16 ND /
Lus10032968 69 / 6e-15 ND /
Lus10010056 58 / 3e-11 ND /
Lus10021601 57 / 6e-11 ND /
Lus10028090 50 / 3e-08 ND /
Lus10029530 47 / 8e-07 ND /
Lus10036287 45 / 4e-06 ND /
Lus10024537 40 / 0.0004 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10002802 pacid=23171444 polypeptide=Lus10002802 locus=Lus10002802.g ID=Lus10002802.BGIv1.0 annot-version=v1.0
ATGGTGCATCGGGAGACACATTGGATCCAGCAAACCCAGGACCGGCAGACTTGGCATATGGCATATTATCATGATGCGTACTTTGGGTTCCTTAACATGA
CTCCGACTATCCGCCCCCCACCCCAGCACCACTTTCAGAATGCAGGAGCTGCATATCTCGGATACTACCTCCACCTGAGCGAGGAGCTCAACTACTATGG
GTACTATCCCCACTTCCCGCCCTTCCAACCACCACCACCTCCACCACCGTTCGAGGGGTTCTTCGCCAAACTACACATCGGCCTCTATATCTCCACATCT
CAGAAGGTGATCACCTTCTGGTTGGGAGGGAAGCTGCACAACATCTCTCTTGATAAGTTTGGGATACTACTAGGGTTGCACACAGAGGATGAGAGGGAGA
GTGGCGACCTTTTTGGACTTACTACCATTGTTGGCACCGAGATCTCTGGTCATAAGGAGTTCTAG
AA sequence
>Lus10002802 pacid=23171444 polypeptide=Lus10002802 locus=Lus10002802.g ID=Lus10002802.BGIv1.0 annot-version=v1.0
MVHRETHWIQQTQDRQTWHMAYYHDAYFGFLNMTPTIRPPPQHHFQNAGAAYLGYYLHLSEELNYYGYYPHFPPFQPPPPPPPFEGFFAKLHIGLYISTS
QKVITFWLGGKLHNISLDKFGILLGLHTEDERESGDLFGLTTIVGTEISGHKEF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10002802 0 1
AT5G41720 unknown protein Lus10011415 5.3 0.6341
ATCG01280 ATCG01280.1, YC... Chloroplast Ycf2;ATPase, AAA t... Lus10007142 7.1 0.7188
Lus10042671 11.2 0.6519
Lus10010603 11.2 0.7002
AT3G51480 ATGLR3.6 glutamate receptor 3.6 (.1) Lus10035980 14.7 0.6981
AT1G11340 S-locus lectin protein kinase ... Lus10006745 19.8 0.6974
AT5G20950 Glycosyl hydrolase family prot... Lus10023604 23.6 0.6776
AT1G60990 Glycine cleavage T-protein fam... Lus10020818 25.0 0.6751
AT1G67750 Pectate lyase family protein (... Lus10011400 30.0 0.6431
Lus10033844 31.7 0.6323

Lus10002802 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.