Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027862 [exp] 54 / 4e-10 AT4G15480 414 / 3e-141 UDP-Glycosyltransferase superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002810 pacid=23158669 polypeptide=Lus10002810 locus=Lus10002810.g ID=Lus10002810.BGIv1.0 annot-version=v1.0 ATGAGCAGAGGAGAAGGTACCACGGTGAAGCGGGATGAGGCGGCGAGGTGTCTGGCGGAGGCGGCGGCGGCGGCGGCGGGGTTCAAGGCGGAGGAGTTGC GGAGAAATGCCGCAAAGTGGAAGAAGAAGACGGACGAGGCGGTGGCGGAGGGCGGATCGTCGGAGAGTAGTGTTGAGGAGTTCGTGGAGATGGTTAAGAA GAACGTGTTTAGTAGGAAATGA
AA sequence Show only first row Show all	>Lus10002810 pacid=23158669 polypeptide=Lus10002810 locus=Lus10002810.g ID=Lus10002810.BGIv1.0 annot-version=v1.0 MSRGEGTTVKRDEAARCLAEAAAAAAGFKAEELRRNAAKWKKKTDEAVAEGGSSESSVEEFVEMVKKNVFSRK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15480		UGT84A1	UDP-Glycosyltransferase superf...		Lus10002810 [exp]	0	1
AT3G04070	NAC	ANAC047	NAC domain containing protein ...		Lus10027357 [exp]	1.7	0.8094
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10018785 [exp]	5.3	0.8055
					Lus10028940 [exp]	6.5	0.8037
AT1G03890			RmlC-like cupins superfamily p...		Lus10033893 [exp]	9.7	0.7655
					Lus10033191 [exp]	11.8	0.7678
AT1G68460		ATIPT1	Arabidopsis thaliana isopenten...		Lus10034333 [exp]	22.6	0.6349
AT2G40220	AP2_ERF	ATABI4, GIN6, S...	SUCROSE UNCOUPLED 6, SUGAR-INS...		Lus10009834 [exp]	28.3	0.7130
					Lus10017181 [exp]	33.8	0.6335
AT2G02955		MEE12	maternal effect embryo arrest ...		Lus10030475 [exp]	35.1	0.6077
AT2G29940		ABCG31, PDR3, A...	ATP-binding cassette G31, plei...		Lus10020550 [exp]	39.5	0.7581

Compare expression of checked genes

Lus10002810 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.