Lus10002815 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G19460 176 / 6e-56 Reticulon family protein (.1.2)
AT2G15280 149 / 4e-45 Reticulon family protein (.1.2)
AT3G10915 110 / 6e-30 Reticulon family protein (.1.2.3.4.5.6)
AT3G61560 98 / 7e-25 Reticulon family protein (.1.2)
AT1G64090 98 / 8e-25 RTNLB3 Reticulan like protein B3 (.1.2)
AT2G46170 97 / 2e-24 Reticulon family protein (.1.2)
AT5G41600 95 / 1e-23 RTNLB4, BTI3 Reticulan like protein B4, VIRB2-interacting protein 3 (.1)
AT4G23630 94 / 3e-23 RTNLB1, BTI1 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
AT3G54120 93 / 3e-23 Reticulon family protein (.1)
AT3G10260 93 / 4e-23 Reticulon family protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027867 341 / 3e-120 AT3G19460 184 / 1e-58 Reticulon family protein (.1.2)
Lus10019812 253 / 6e-86 AT3G19460 208 / 1e-68 Reticulon family protein (.1.2)
Lus10014102 232 / 1e-77 AT3G19460 209 / 5e-69 Reticulon family protein (.1.2)
Lus10034224 114 / 4e-31 AT3G10915 291 / 1e-100 Reticulon family protein (.1.2.3.4.5.6)
Lus10032451 112 / 1e-30 AT3G18260 268 / 9e-92 Reticulon family protein (.1)
Lus10035537 97 / 8e-25 AT3G54120 185 / 2e-59 Reticulon family protein (.1)
Lus10027756 96 / 2e-24 AT3G54120 181 / 1e-57 Reticulon family protein (.1)
Lus10029822 97 / 3e-24 AT3G10260 330 / 2e-115 Reticulon family protein (.1.2.3)
Lus10038833 96 / 4e-24 AT5G41600 308 / 3e-106 Reticulan like protein B4, VIRB2-interacting protein 3 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G300400 209 / 1e-68 AT3G19460 145 / 8e-44 Reticulon family protein (.1.2)
Potri.009G096200 183 / 2e-58 AT2G15280 132 / 1e-38 Reticulon family protein (.1.2)
Potri.019G057400 121 / 7e-34 AT3G10915 260 / 6e-88 Reticulon family protein (.1.2.3.4.5.6)
Potri.016G110200 116 / 2e-32 AT3G54120 193 / 1e-62 Reticulon family protein (.1)
Potri.014G091200 106 / 3e-28 AT2G46170 318 / 3e-110 Reticulon family protein (.1.2)
Potri.012G035600 99 / 4e-25 AT4G23630 296 / 2e-101 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.015G027300 97 / 2e-24 AT4G23630 310 / 6e-107 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
Potri.005G206800 94 / 4e-23 AT3G10260 315 / 3e-109 Reticulon family protein (.1.2.3)
Potri.015G044300 92 / 7e-23 AT3G18260 251 / 1e-84 Reticulon family protein (.1)
Potri.001G097700 93 / 8e-23 AT4G23630 314 / 2e-108 Reticulan like protein B1, VIRB2-interacting protein 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0484 Peroxisome PF02453 Reticulon Reticulon
Representative CDS sequence
>Lus10002815 pacid=23158650 polypeptide=Lus10002815 locus=Lus10002815.g ID=Lus10002815.BGIv1.0 annot-version=v1.0
ATGGGAGACACCGTGGATCCTCCTCCTCCTCCACCTCATCGCACCACCGTCCACGAGATGCTCGGCGGCGGCTCAGTTGCTGATGCTCTTCTATGGCGGA
GATGGGGGAAAAGCGTGAAGTTGTTAATCTTCTCGACGACGTCGTGGTACCTGTTCGAGCGAGCAGGATACAATCTGATGACGTTCGTCGCGAACGTGTT
GTTCTCGCTCGTCGTTATCCTCTTCCTCTGGGCGAAATCTGCTTCTCTTCTCAATCGGCCGCTACCCCCGAATCCCCCACCTCACAAAAAAAAAAAAGAA
ATAACTGAGGAGACTGTGGATAAGATTGTGCATGTTGCTCAAGGCTATGTCAACAATGTGTTGGCTATTGGATGTGACATTGCAGTTGAGAGGAACTTGA
AGGTTTTCCTACAGGTTTCATTCGTCACGTGGCTCGTTTCATACGTTGGTAGCCTCTTCAGTTTCCTTACTTTTGTATACGTTGGGGTACTTCTTAGTCT
TTCTATTCCGGTGCTATATGAAAGATTCCAGCACCGGATTGATGAGAATCTGCTCGTGTTACGGAGAATACTCGACTCTCAGTTTAGAAACCTTCTGAAG
AAGATTCCAGCACCATCACGTAAGGAGAAGAAGGTCCAATAG
AA sequence
>Lus10002815 pacid=23158650 polypeptide=Lus10002815 locus=Lus10002815.g ID=Lus10002815.BGIv1.0 annot-version=v1.0
MGDTVDPPPPPPHRTTVHEMLGGGSVADALLWRRWGKSVKLLIFSTTSWYLFERAGYNLMTFVANVLFSLVVILFLWAKSASLLNRPLPPNPPPHKKKKE
ITEETVDKIVHVAQGYVNNVLAIGCDIAVERNLKVFLQVSFVTWLVSYVGSLFSFLTFVYVGVLLSLSIPVLYERFQHRIDENLLVLRRILDSQFRNLLK
KIPAPSRKEKKVQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G19460 Reticulon family protein (.1.2... Lus10002815 0 1
AT3G19460 Reticulon family protein (.1.2... Lus10027867 1.0 0.9326
AT4G19670 RING/U-box superfamily protein... Lus10040616 2.4 0.9298
AT3G23690 bHLH bHLH077 basic helix-loop-helix (bHLH) ... Lus10021968 7.3 0.9159
AT2G04780 FLA7 FASCICLIN-like arabinoogalacta... Lus10006399 8.4 0.9128
AT1G15880 ATGOS11, GOS11 golgi snare 11 (.1) Lus10014349 11.2 0.8886
AT1G13900 Purple acid phosphatases super... Lus10026652 11.7 0.9115
AT2G34790 MEE23, EDA28 MATERNAL EFFECT EMBRYO ARREST ... Lus10023361 14.0 0.9178
AT5G51490 Plant invertase/pectin methyle... Lus10031720 14.1 0.9083
AT1G17270 O-fucosyltransferase family pr... Lus10037461 15.6 0.9241
AT1G68795 CLE12 CLAVATA3/ESR-RELATED 12 (.1) Lus10041496 16.7 0.9242

Lus10002815 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.