Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G34190 87 / 8e-24 SEP1 stress enhanced protein 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027871 [exp] 99 / 2e-28 AT4G34190 128 / 1e-38 stress enhanced protein 1 (.1) Lus10002821 [exp] 99 / 5e-28 AT4G34190 119 / 2e-34 stress enhanced protein 1 (.1) Lus10014093 [exp] 79 / 1e-20 AT4G34190 116 / 7e-34 stress enhanced protein 1 (.1) Lus10019821 [exp] 79 / 1e-20 AT4G34190 119 / 6e-35 stress enhanced protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G301100 [exp] 79 / 1e-20 AT4G34190 140 / 1e-43 stress enhanced protein 1 (.1) Potri.009G096800 [exp] 77 / 5e-20 AT4G34190 130 / 1e-39 stress enhanced protein 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002818 pacid=23158653 polypeptide=Lus10002818 locus=Lus10002818.g ID=Lus10002818.BGIv1.0 annot-version=v1.0 ATGGCTAGGGCGAGCCGGGATGATTGGTTCGCTGTGGCGATCACGGTTGAAGTATCTACCGGGAAAGGCCTCCTACAGAATTTCGGGATGGCGAGCCCCA TGCCTACGGCTGCATTGGCGATAACCGGATTAGTTGGTGTGCTCACTGCAGTGTTCATCTTCCAGTCCTCGTCGAAAAGTTGA
AA sequence Show only first row Show all	>Lus10002818 pacid=23158653 polypeptide=Lus10002818 locus=Lus10002818.g ID=Lus10002818.BGIv1.0 annot-version=v1.0 MARASRDDWFAVAITVEVSTGKGLLQNFGMASPMPTAALAITGLVGVLTAVFIFQSSSKS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G34190		SEP1	stress enhanced protein 1 (.1)		Lus10002818 [exp]	0	1
					Lus10006063 [exp]	10.5	0.7915
AT1G09190			Tetratricopeptide repeat (TPR)...		Lus10034889 [exp]	13.0	0.8577
					Lus10012943 [exp]	13.6	0.7502
					Lus10017698 [exp]	19.1	0.7352
					Lus10007398 [exp]	21.4	0.8465
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10030411 [exp]	22.5	0.7124
AT5G37060		ATCHX24	cation/H+ exchanger 24, ARABID...		Lus10026398 [exp]	25.2	0.8005
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10036868 [exp]	29.0	0.7017
AT1G33590			Leucine-rich repeat (LRR) fami...		Lus10006160 [exp]	30.5	0.7020
					Lus10017966 [exp]	32.9	0.7539

Compare expression of checked genes

Lus10002818 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.