Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70400 128 / 9e-39 unknown protein AT1G60170 135 / 2e-38 EMB1220 embryo defective 1220, pre-mRNA processing ribonucleoprotein binding region-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029168 [exp] 160 / 8e-48 AT1G60170 707 / 0.0 embryo defective 1220, pre-mRNA processing ribonucleoprotein binding region-containing protein (.1) Lus10012997 [exp] 160 / 1e-47 AT1G60170 705 / 0.0 embryo defective 1220, pre-mRNA processing ribonucleoprotein binding region-containing protein (.1) Lus10027881 [exp] 135 / 4e-40 AT1G60170 198 / 4e-60 embryo defective 1220, pre-mRNA processing ribonucleoprotein binding region-containing protein (.1) Lus10028269 [exp] 52 / 7e-10 AT1G70400 65 / 2e-14 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G176000 [exp] 173 / 6e-53 AT1G60170 591 / 0.0 embryo defective 1220, pre-mRNA processing ribonucleoprotein binding region-containing protein (.1) Potri.014G102800 [exp] 171 / 3e-52 AT1G60170 610 / 0.0 embryo defective 1220, pre-mRNA processing ribonucleoprotein binding region-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence Show only first row Show all	>Lus10002830 pacid=23158656 polypeptide=Lus10002830 locus=Lus10002830.g ID=Lus10002830.BGIv1.0 annot-version=v1.0 ATGCTCAAAGTGGAGGAAGCCTTAGCGAGAGGTGATCAAGGGAGAATGGTCTTGCGAGATGATCCTGAGTACCAACTGATAGTGGATTGCAATGCGTTGT CTGTAGACATAGAGAACGAGATTACCATCATCCACAACTTCATCCGCGACAAGTACCGGTCCAAGTTCCCCGAGCTAGAGTCTCTCGTGCGCGATCCCGT CGAATACTCTCGCGTGGTGAAGAGAATCAGGAACGAGATGGATATAACCCTCGTTGATCTCGAAGGTCTTTTGCCCTCGGTCGCCATTATGGTCGTTTCA GTGACTGCATTGACAACAAGCGGTAAACCTCTCCCCTCGACGTTCTCCAAACGCTTATTGATGCTTGTGATCGGATTCTAA
AA sequence Show only first row Show all	>Lus10002830 pacid=23158656 polypeptide=Lus10002830 locus=Lus10002830.g ID=Lus10002830.BGIv1.0 annot-version=v1.0 MLKVEEALARGDQGRMVLRDDPEYQLIVDCNALSVDIENEITIIHNFIRDKYRSKFPELESLVRDPVEYSRVVKRIRNEMDITLVDLEGLLPSVAIMVVS VTALTTSGKPLPSTFSKRLLMLVIGF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G60170		EMB1220	embryo defective 1220, pre-mRN...		Lus10002830 [exp]	0	1
AT4G18690			unknown protein		Lus10025399 [exp]	1.4	0.8315
AT3G13400		SKS13	SKU5 similar 13 (.1)		Lus10010358 [exp]	5.1	0.8044
AT3G14470			NB-ARC domain-containing disea...		Lus10011855 [exp]	7.6	0.7366
AT1G66370	MYB	ATMYB113	myb domain protein 113 (.1)		Lus10028513 [exp]	9.9	0.7660
AT1G03495			HXXXD-type acyl-transferase fa...		Lus10039720 [exp]	10.8	0.7575
AT4G27280			Calcium-binding EF-hand family...		Lus10039724 [exp]	13.0	0.7835
AT3G07360		ATPUB9	ARABIDOPSIS THALIANA PLANT U-B...		Lus10024776 [exp]	13.6	0.7918
AT5G27530			Pectin lyase-like superfamily ...		Lus10036205 [exp]	17.9	0.7893
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10006555 [exp]	21.0	0.7756
AT2G02120		PDF2.1, LCR70	LOW-MOLECULAR-WEIGHT CYSTEINE-...		Lus10039622 [exp]	22.4	0.7226

Compare expression of checked genes

Lus10002830 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.