Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G60170 93 / 3e-23 EMB1220 embryo defective 1220, pre-mRNA processing ribonucleoprotein binding region-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027882 [exp] 139 / 2e-43 AT1G60170 148 / 2e-43 embryo defective 1220, pre-mRNA processing ribonucleoprotein binding region-containing protein (.1) Lus10029168 [exp] 129 / 2e-36 AT1G60170 707 / 0.0 embryo defective 1220, pre-mRNA processing ribonucleoprotein binding region-containing protein (.1) Lus10012997 [exp] 129 / 5e-36 AT1G60170 705 / 0.0 embryo defective 1220, pre-mRNA processing ribonucleoprotein binding region-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G176000 [exp] 120 / 2e-33 AT1G60170 591 / 0.0 embryo defective 1220, pre-mRNA processing ribonucleoprotein binding region-containing protein (.1) Potri.014G102800 [exp] 120 / 3e-33 AT1G60170 610 / 0.0 embryo defective 1220, pre-mRNA processing ribonucleoprotein binding region-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF09785 [flax] [poplar] Prp31_C Prp31 C terminal domain
Representative CDS sequence Show only first row Show all	>Lus10002831 pacid=23158649 polypeptide=Lus10002831 locus=Lus10002831.g ID=Lus10002831.BGIv1.0 annot-version=v1.0 ATGAAAGAGAGATATGCAGAGACGGACATAGGAGGCTTGCCAACAGGATGCAGTGACGGGCTAGGGGTAGGCTATGGAATGCTCGGTCAGGCAGGAAGCG GGAGGCTTCGAGTAGTAGCGAGACAGAACAAACTTGCTGCTAAAGTAGCAAAGAGGTTCAAGGAGAAGCATTATGGCGGCAGCACATCCGGTCTGGCTTC GAGTCTAGCATTCACACCTGCGCAGAGGATTGAGCTGAGTAATCCACAAGTGTATGCACAACAATTCGGAGGTGGAATTCGAAGTACCTACTTCTCGGAG ACCCGCACCTTTTCCAATATCAAGAGGACCTGA
AA sequence Show only first row Show all	>Lus10002831 pacid=23158649 polypeptide=Lus10002831 locus=Lus10002831.g ID=Lus10002831.BGIv1.0 annot-version=v1.0 MKERYAETDIGGLPTGCSDGLGVGYGMLGQAGSGRLRVVARQNKLAAKVAKRFKEKHYGGSTSGLASSLAFTPAQRIELSNPQVYAQQFGGGIRSTYFSE TRTFSNIKRT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G60170		EMB1220	embryo defective 1220, pre-mRN...		Lus10002831 [exp]	0	1
AT3G24503		ALDH1A, REF1, A...	REDUCED EPIDERMAL FLUORESCENCE...		Lus10024260 [exp]	1.4	0.9997
AT5G39160			RmlC-like cupins superfamily p...		Lus10034254 [exp]	2.0	0.9997
AT3G08990			Yippee family putative zinc-bi...		Lus10004823 [exp]	2.4	0.9979
AT4G39830			Cupredoxin superfamily protein...		Lus10009603 [exp]	3.5	0.9955
					Lus10009892 [exp]	5.5	0.9847
AT5G58850	MYB	ATMYB119	myb domain protein 119 (.1)		Lus10018220 [exp]	6.9	0.9628
AT2G23945			Eukaryotic aspartyl protease f...		Lus10031113 [exp]	7.3	0.9722
AT1G13680			PLC-like phosphodiesterases su...		Lus10000649 [exp]	7.5	0.9699
AT5G44390			FAD-binding Berberine family p...		Lus10042382 [exp]	9.4	0.9497
AT3G25910			Protein of unknown function (D...		Lus10026800 [exp]	9.9	0.8659

Compare expression of checked genes

Lus10002831 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.