Lus10002848 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G08950 169 / 5e-53 HCC1 homologue of the copper chaperone SCO1, electron transport SCO1/SenC family protein (.1)
AT4G39740 92 / 2e-23 HCC2 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016805 99 / 4e-26 AT4G39740 328 / 9e-114 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G118700 169 / 7e-53 AT3G08950 352 / 1e-121 homologue of the copper chaperone SCO1, electron transport SCO1/SenC family protein (.1)
Potri.007G091300 105 / 1e-28 AT4G39740 310 / 1e-106 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
Potri.005G076700 97 / 2e-25 AT4G39740 328 / 1e-113 homologue of copper chaperone SCO1 2, Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF02630 SCO1-SenC SCO1/SenC
Representative CDS sequence
>Lus10002848 pacid=23181318 polypeptide=Lus10002848 locus=Lus10002848.g ID=Lus10002848.BGIv1.0 annot-version=v1.0
ATGTCTGGATCTTTATCTTCTGCTTTTGTAGAGAAGAAAGCAGGGTTCGAGATAGTCCCCGTTTTTATATATGTTGATCCCGAGAGAGACACTGTTGACC
AAGTGCGGGAGTATGTAAAAGAGTATCATCCAAGCTTAGTTGGGTTGACTGGCACACCGGCTGATATAAAGAATGTCGCCCGTGCATATCGAGTGTATTA
TATGAAGACCGCCGAGGAAGATTACCTGGTTGATCACTCCATTGTCATGTACTTGATGAGTCCCAACATGCAATTTGTGAAGTTCTTCGGGAAGAATCAC
GACGATGAGTCGCTCACTGATGGAATCATCAACGAGATTAAGCGATACAAAGCAGAAGTGGCGAAGAAGAGTTCACCAAATCATCCATAG
AA sequence
>Lus10002848 pacid=23181318 polypeptide=Lus10002848 locus=Lus10002848.g ID=Lus10002848.BGIv1.0 annot-version=v1.0
MSGSLSSAFVEKKAGFEIVPVFIYVDPERDTVDQVREYVKEYHPSLVGLTGTPADIKNVARAYRVYYMKTAEEDYLVDHSIVMYLMSPNMQFVKFFGKNH
DDESLTDGIINEIKRYKAEVAKKSSPNHP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G08950 HCC1 homologue of the copper chaper... Lus10002848 0 1
AT3G07800 Thymidine kinase (.1) Lus10006394 19.4 0.6904
AT4G35150 O-methyltransferase family pro... Lus10033653 22.0 0.6773
AT4G35160 O-methyltransferase family pro... Lus10007035 66.6 0.6771
AT2G32450 Calcium-binding tetratricopept... Lus10038571 67.1 0.6275
AT5G48540 receptor-like protein kinase-r... Lus10014362 88.2 0.6160
Lus10037674 116.9 0.6623
Lus10003448 198.8 0.6113

Lus10002848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.