Lus10002853 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G38360 304 / 2e-105 PRA1.B4 prenylated RAB acceptor 1.B4 (.1)
AT3G56110 243 / 2e-81 PRA1.B1 prenylated RAB acceptor 1.B1 (.1.2)
AT5G01640 241 / 8e-81 PRA1.B5 prenylated RAB acceptor 1.B5 (.1)
AT5G05380 226 / 6e-75 PRA1.B3 prenylated RAB acceptor 1.B3 (.1)
AT2G40380 219 / 3e-72 PRA1.B2 prenylated RAB acceptor 1.B2 (.1)
AT5G07110 182 / 2e-57 PRA1.B6 prenylated RAB acceptor 1.B6 (.1)
AT4G00005 122 / 2e-35 PRA1 (Prenylated rab acceptor) family protein (.1)
AT1G55190 112 / 2e-30 PRA7, PRA1.F2 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
AT3G13710 107 / 2e-28 PRA1.F4 prenylated RAB acceptor 1.F4 (.1)
AT1G08770 102 / 2e-26 PRA1.E prenylated RAB acceptor 1.E (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012224 370 / 1e-131 AT2G38360 310 / 3e-108 prenylated RAB acceptor 1.B4 (.1)
Lus10042246 249 / 3e-83 AT2G38360 250 / 4e-84 prenylated RAB acceptor 1.B4 (.1)
Lus10017425 244 / 9e-82 AT2G38360 281 / 9e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10007533 243 / 2e-81 AT2G38360 281 / 6e-97 prenylated RAB acceptor 1.B4 (.1)
Lus10009842 241 / 1e-80 AT2G38360 278 / 1e-95 prenylated RAB acceptor 1.B4 (.1)
Lus10026404 240 / 3e-80 AT2G38360 253 / 5e-86 prenylated RAB acceptor 1.B4 (.1)
Lus10022680 235 / 4e-79 AT2G38360 232 / 1e-78 prenylated RAB acceptor 1.B4 (.1)
Lus10014234 156 / 7e-48 AT2G38360 164 / 1e-51 prenylated RAB acceptor 1.B4 (.1)
Lus10005088 119 / 6e-33 AT1G55190 199 / 3e-65 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G126400 254 / 1e-85 AT2G38360 209 / 2e-68 prenylated RAB acceptor 1.B4 (.1)
Potri.008G074000 248 / 2e-83 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.008G074033 248 / 2e-83 AT3G56110 213 / 2e-70 prenylated RAB acceptor 1.B1 (.1.2)
Potri.010G183300 246 / 7e-83 AT3G56110 239 / 9e-81 prenylated RAB acceptor 1.B1 (.1.2)
Potri.006G104400 243 / 3e-81 AT2G38360 206 / 5e-67 prenylated RAB acceptor 1.B4 (.1)
Potri.019G124100 203 / 5e-66 AT5G05380 140 / 8e-42 prenylated RAB acceptor 1.B3 (.1)
Potri.005G219100 134 / 5e-39 AT1G55190 132 / 8e-39 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.002G044000 127 / 3e-36 AT1G55190 130 / 4e-38 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
Potri.005G054700 126 / 1e-35 AT1G08770 137 / 1e-40 prenylated RAB acceptor 1.E (.1)
Potri.002G043800 123 / 8e-35 AT1G55190 136 / 1e-40 PRENYLATED RAB ACCEPTOR 1.F2, PRA1 (Prenylated rab acceptor) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03208 PRA1 PRA1 family protein
Representative CDS sequence
>Lus10002853 pacid=23181326 polypeptide=Lus10002853 locus=Lus10002853.g ID=Lus10002853.BGIv1.0 annot-version=v1.0
ATGGCTGCAGCTTCATCCCCTCCAATCCTCCCGATCTCCAACTCCCAATCCATCTCCATCACCACCGCCGAATCCCAGCCACCGATCGCCACCCCAGCCT
TCCGCTCCTTCATCAACAAGATCTCCGACACCGTCCGCAACGGCCTCTCCCAGCGCCGCCCCTGGGCAGAGCTCACCGACCGCTCCGCGTGGGCAGAGCT
CGCCGACCGATCCGCCTTCTCCAAGCCGGATTCCGTCTCCGACGCCACTCTCCGCCTCCGCAAGAACTACGCCTACTTCCGCGTCAATTACCTCACCGCG
GTGGCCGCGATCCTCGCCTTCTCGTTGATCTCCCATCCTTTCTCCCTCATCCTCCTGATCGGACTCCTCGCCTCGTGGATATTCCTCTACCTATTCCGCC
CCGCCGATCAGCCGCTCGTCATCCTCGGCCGTACATTCAACGACATGGAGACGCTCGGGCTCCTGGCCTTGCTCAGCATCGTCGTCGTTTTCCTGACCAG
CGTCGGATCCATCCTCATCTCGGGGCTCATGGTTGGAGCCGCCATCGTTTGTGCGCACGGCGCGTTCAGGGTCCCTGAGGATCTGTTTCTCGACGAGCAG
GAGCCTGCCGCCGCTACTGGATTCCTGTCGTTCCTCGGTGGCGCTGCTTCGAACGTAGCTGCGACTACTGCCGCCCCTGTCGTTCTGTCCAGAGAATCAG
GTGGTTCAACAACGATTCATGATCCGCCTTGA
AA sequence
>Lus10002853 pacid=23181326 polypeptide=Lus10002853 locus=Lus10002853.g ID=Lus10002853.BGIv1.0 annot-version=v1.0
MAAASSPPILPISNSQSISITTAESQPPIATPAFRSFINKISDTVRNGLSQRRPWAELTDRSAWAELADRSAFSKPDSVSDATLRLRKNYAYFRVNYLTA
VAAILAFSLISHPFSLILLIGLLASWIFLYLFRPADQPLVILGRTFNDMETLGLLALLSIVVVFLTSVGSILISGLMVGAAIVCAHGAFRVPEDLFLDEQ
EPAAATGFLSFLGGAASNVAATTAAPVVLSRESGGSTTIHDPP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10002853 0 1
AT1G76920 F-box family protein (.1) Lus10018896 1.7 0.8993
AT5G59550 zinc finger (C3HC4-type RING f... Lus10040783 2.4 0.8866
AT3G63000 NPL41 NPL4-like protein 1 (.1) Lus10017163 3.2 0.8934
AT5G42050 DCD (Development and Cell Deat... Lus10023059 4.0 0.8794
AT1G73500 ATMKK9 MAP kinase kinase 9 (.1) Lus10040127 4.9 0.8714
AT4G29680 Alkaline-phosphatase-like fami... Lus10008562 5.0 0.8770
Lus10018015 5.3 0.8694
AT1G08315 ARM repeat superfamily protein... Lus10008655 8.5 0.8422
AT2G30360 PKS5, CIPK11, S... SNF1-RELATED PROTEIN KINASE 3.... Lus10009925 8.8 0.8583
AT4G19950 unknown protein Lus10038358 9.0 0.8666

Lus10002853 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.