Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51740 188 / 2e-56 IMK2 inflorescence meristem receptor-like kinase 2 (.1) AT3G56100 166 / 1e-48 IMK3, MRLK meristematic receptor-like kinase (.1) AT3G08680 101 / 1e-25 Leucine-rich repeat protein kinase family protein (.1.2) AT1G68400 100 / 4e-25 leucine-rich repeat transmembrane protein kinase family protein (.1) AT5G58300 99 / 7e-25 Leucine-rich repeat protein kinase family protein (.1.2) AT2G26730 99 / 1e-24 Leucine-rich repeat protein kinase family protein (.1) AT3G17840 94 / 5e-23 RLK902 receptor-like kinase 902 (.1) AT5G05160 93 / 1e-22 REDUCED IN LATERAL GROWTH1 (RUL1) REDUCED IN LATERAL GROWTH1, Leucine-rich repeat protein kinase family protein (.1) AT4G23740 91 / 9e-22 Leucine-rich repeat protein kinase family protein (.1) AT1G48480 90 / 1e-21 RKL1 receptor-like kinase 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012225 [exp] 269 / 2e-88 AT3G51740 679 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Lus10014236 [exp] 189 / 6e-57 AT3G51740 907 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Lus10022679 [exp] 188 / 2e-56 AT3G51740 926 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Lus10014235 [exp] 184 / 6e-55 AT3G51740 933 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Lus10022678 [exp] 179 / 6e-53 AT3G51740 885 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Lus10002299 [exp] 108 / 4e-29 AT1G48480 433 / 5e-149 receptor-like kinase 1 (.1) Lus10033065 [exp] 110 / 8e-29 AT2G26730 768 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Lus10004040 [exp] 110 / 1e-28 AT1G48480 694 / 0.0 receptor-like kinase 1 (.1) Lus10017756 [exp] 108 / 7e-28 AT2G26730 877 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G126300 [exp] 202 / 1e-61 AT3G51740 1038 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Potri.006G104300 [exp] 199 / 3e-60 AT3G51740 996 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Potri.010G183400 [exp] 186 / 2e-55 AT3G51740 903 / 0.0 inflorescence meristem receptor-like kinase 2 (.1) Potri.019G062100 [exp] 104 / 1e-26 AT5G58300 750 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2) Potri.018G074300 [exp] 98 / 2e-24 AT2G26730 550 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.010G121700 [exp] 97 / 4e-24 AT1G68400 760 / 0.0 leucine-rich repeat transmembrane protein kinase family protein (.1) Potri.013G158800 [exp] 97 / 6e-24 AT5G58300 798 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2) Potri.017G130600 [exp] 96 / 9e-24 AT5G16590 649 / 0.0 Leucine rich repeat protein 1, Leucine-rich repeat protein kinase family protein (.1) Potri.001G095200 [exp] 96 / 9e-24 AT4G23740 751 / 0.0 Leucine-rich repeat protein kinase family protein (.1) Potri.019G131500 [exp] 96 / 1e-23 AT5G58300 860 / 0.0 Leucine-rich repeat protein kinase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF00069 [flax] [poplar] Pkinase Protein kinase domain
Representative CDS sequence Show only first row Show all	>Lus10002854 pacid=23181309 polypeptide=Lus10002854 locus=Lus10002854.g ID=Lus10002854.BGIv1.0 annot-version=v1.0 ATGACCGACGCTGCCGCCGCGACGAACGTGATTTCCACCGCAGGAACACTATGTTACCGAGCGCCCGAGCTCTCAACGAAGATGAAAAATGCCGCCGGGA CGAAGAGTGACGTTTACAGCCTGGGAGTGATCATTCTGGAGCTGCTGACGGGGAAATCCCCTGGAGAGACGAACAACGGGATGGCTCTGCCGCAGTGGGT GGCTTCGATCGTGAAGGAGGAGTGGACGAATGAAGTTTTCGATTTGGAGATATCCTACAACTCATCGACAGCTACTGGCGATGAGCTTCTGAACGCTCTG AAGCTGGCTTTGCATTGCGTTGATCCGTCGCCGCCGTCGAGGCCAGAAGCTGGGGAAGTTCTCCAGCAGCTGGAGGAGATTAAGGCGGAGCTGGCGACTG AAGGTGGTGGTGTTCCAGCAGATGACGGAATTAAAACCCCGCCAATGACGGATTAG
AA sequence Show only first row Show all	>Lus10002854 pacid=23181309 polypeptide=Lus10002854 locus=Lus10002854.g ID=Lus10002854.BGIv1.0 annot-version=v1.0 MTDAAAATNVISTAGTLCYRAPELSTKMKNAAGTKSDVYSLGVIILELLTGKSPGETNNGMALPQWVASIVKEEWTNEVFDLEISYNSSTATGDELLNAL KLALHCVDPSPPSRPEAGEVLQQLEEIKAELATEGGGVPADDGIKTPPMTD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51740		IMK2	inflorescence meristem recepto...		Lus10002854 [exp]	0	1
AT3G51740		IMK2	inflorescence meristem recepto...		Lus10012225 [exp]	2.0	0.9145
AT3G54400			Eukaryotic aspartyl protease f...		Lus10024148 [exp]	6.7	0.8970
AT1G70340			Plant protein of unknown funct...		Lus10029158 [exp]	7.6	0.9226
AT5G41460			Protein of unknown function (D...		Lus10028768 [exp]	13.2	0.8704
AT4G19010			AMP-dependent synthetase and l...		Lus10016630 [exp]	21.6	0.8575
AT5G06150		CYC1BAT, CYCB1;...	cyclin B 1;2, Cyclin family pr...		Lus10003800 [exp]	23.7	0.8990
AT5G50890			alpha/beta-Hydrolases superfam...		Lus10020755 [exp]	25.0	0.8878
AT4G24265			unknown protein		Lus10007441 [exp]	25.1	0.8514
AT5G01910			unknown protein		Lus10014179 [exp]	25.3	0.8901
AT2G02955		MEE12	maternal effect embryo arrest ...		Lus10030476 [exp]	26.4	0.8061

Compare expression of checked genes

Lus10002854 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.