Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38310 174 / 2e-55 RCAR10, PYL4 regulatory components of ABA receptor 10, PYR1-like 4 (.1) AT2G40330 166 / 4e-52 RCAR9, PYL6 regulatory components of ABA receptor 9, PYR1-like 6 (.1) AT5G05440 162 / 7e-51 RCAR8, PYL5 regulatory component of ABA receptor 8, PYRABACTIN RESISTANCE 1-LIKE 5, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G01360 140 / 3e-42 PYL9, RCAR1 PYRABACTIN RESISTANCE 1-LIKE 9, regulatory component of ABA receptor 1 (.1) AT4G01026 138 / 3e-41 RCAR2, PYL7 regulatory components of ABA receptor 2, PYR1-like 7 (.1) AT5G53160 136 / 1e-40 RCAR3, PYL8 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) AT2G26040 134 / 1e-39 RCAR14, PYL2 regulatory components of ABA receptor 14, PYR1-like 2 (.1) AT4G17870 129 / 7e-38 RCAR11, PYR1 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT4G27920 122 / 3e-35 RCAR4, PYL10 regulatory components of ABA receptor 4, PYR1-like 10 (.1) AT1G73000 118 / 3e-33 RCAR13, PYL3 regulatory components of ABA receptor 13, PYR1-like 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012231 [exp] 247 / 8e-84 AT2G38310 234 / 1e-78 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10014239 [exp] 207 / 3e-68 AT2G38310 250 / 5e-85 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10022675 [exp] 206 / 1e-66 AT2G38310 249 / 1e-83 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007530 [exp] 190 / 2e-62 AT2G38310 198 / 1e-65 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Lus10007275 [exp] 138 / 3e-41 AT2G40330 183 / 1e-58 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Lus10001059 [exp] 135 / 4e-40 AT5G53160 306 / 1e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10024991 [exp] 134 / 2e-39 AT2G26040 264 / 7e-91 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Lus10039335 [exp] 134 / 2e-39 AT5G53160 295 / 4e-103 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Lus10026430 [exp] 134 / 2e-39 AT2G26040 264 / 1e-90 regulatory components of ABA receptor 14, PYR1-like 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G125400 [exp] 226 / 2e-75 AT2G38310 256 / 3e-87 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.006G104100 [exp] 222 / 6e-74 AT2G38310 249 / 2e-84 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.010G183900 [exp] 173 / 8e-55 AT2G40330 243 / 8e-82 regulatory components of ABA receptor 9, PYR1-like 6 (.1) Potri.008G073400 [exp] 172 / 3e-54 AT2G38310 229 / 2e-76 regulatory components of ABA receptor 10, PYR1-like 4 (.1) Potri.006G230600 [exp] 139 / 1e-41 AT2G26040 266 / 6e-92 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.018G054400 [exp] 138 / 2e-41 AT2G26040 273 / 1e-94 regulatory components of ABA receptor 14, PYR1-like 2 (.1) Potri.012G000800 [exp] 138 / 3e-41 AT5G53160 303 / 1e-106 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.015G020500 [exp] 137 / 5e-41 AT5G53160 304 / 7e-107 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.003G139200 [exp] 137 / 7e-41 AT5G53160 297 / 3e-104 PYR1-like 8, regulatory components of ABA receptor 3 (.1.2) Potri.001G142500 [exp] 136 / 2e-40 AT4G17870 286 / 1e-99 regulatory component of ABA receptor 11, PYRABACTIN RESISTANCE 1, Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF10604 [flax] [poplar] Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence Show only first row Show all	>Lus10002861 pacid=23181331 polypeptide=Lus10002861 locus=Lus10002861.g ID=Lus10002861.BGIv1.0 annot-version=v1.0 ATGCCTCCCAATCCTCCCAAATCCTCAATCGGCGTCCACGCCACCGCCACCACCGCCGTCTCCACCACCGCCGCCTGCCAGAAGCGGCGGTGGTCATGCA CTCCTCACCTCCCGTCGGTCGCCAATCCGCTCCCTGACGCCGTCGCCAATCCGGCGGTTCGACAACCCGCAGGCGTACAAGCACTTCGTCAAGAGCTGCC ACGTCCCTGCAACGTCATCCTCGGTGACGGGGCCGTGGGCACGCTCCGCGAGGTCCATGTGATCTCCGGGCTGCCGGCCGCCAACAGTACGGAGCGGCTC GAGATCCTAGACGACGAAAGACACGTCATAAGCTTCAGCGTCGTGGGTGGGGACCACAGGCTAGCTAACTATCGGTCGGTAACAACTTTACACCCCGCGC CGTCGGGATCCGGCACGGTGGTGGTGGAGTCGTACGTCGTCGACACGCCGCCGGGGAATACGAAGGAGGACACGTGTGTGTTTGTCGACACGATCGTAAG GTGTAACCTCCAGTCGTTGGCTCAGATCGCCGAGAACTCCGCGCGGCGGAGCAATAAAACGGCGTCGTTCGCGTCGTAG
AA sequence Show only first row Show all	>Lus10002861 pacid=23181331 polypeptide=Lus10002861 locus=Lus10002861.g ID=Lus10002861.BGIv1.0 annot-version=v1.0 MPPNPPKSSIGVHATATTAVSTTAACQKRRWSCTPHLPSVANPLPDAVANPAVRQPAGVQALRQELPRPCNVILGDGAVGTLREVHVISGLPAANSTERL EILDDERHVISFSVVGGDHRLANYRSVTTLHPAPSGSGTVVVESYVVDTPPGNTKEDTCVFVDTIVRCNLQSLAQIAENSARRSNKTASFAS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Lus10002861 [exp]	0	1
AT2G38310		RCAR10, PYL4	regulatory components of ABA r...		Lus10012231 [exp]	13.9	0.7548
AT2G30990			Protein of unknown function (D...		Lus10033602 [exp]	19.0	0.7911
AT1G77700			Pathogenesis-related thaumatin...		Lus10025629 [exp]	27.9	0.7854
AT1G21270		WAK2	wall-associated kinase 2 (.1)		Lus10013383 [exp]	31.3	0.7814
AT1G10550		XTH33, XET	xyloglucan:xyloglucosyl transf...		Lus10029165 [exp]	33.2	0.7437
AT4G30360		ATCNGC17	cyclic nucleotide-gated channe...		Lus10015510 [exp]	46.9	0.7692
AT1G70590			F-box family protein (.1)		Lus10026694 [exp]	52.0	0.7663
AT1G14920	GRAS	RGA2, GAI	RESTORATION ON GROWTH ON AMMON...		Lus10033061 [exp]	59.7	0.7702
AT2G18660		AtPNP-A, PNP-A,...	plant natriuretic peptide A (....		Lus10019444 [exp]	81.4	0.7176
AT1G68360	C2H2ZnF		C2H2 and C2HC zinc fingers sup...		Lus10029204 [exp]	91.0	0.7426

Compare expression of checked genes

Lus10002861 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.