Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012234 [exp] 105 / 5e-31 ND / Lus10041628 [exp] 40 / 2e-05 AT5G43150 52 / 3e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G103800 [exp] 55 / 3e-11 ND / Potri.016G124300 [exp] 50 / 1e-09 ND / Potri.003G187500 [exp] 38 / 0.0001 AT5G43150 51 / 8e-10 unknown protein Potri.001G037400 [exp] 37 / 0.0002 AT5G43150 56 / 1e-11 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002866 pacid=23181317 polypeptide=Lus10002866 locus=Lus10002866.g ID=Lus10002866.BGIv1.0 annot-version=v1.0 ATGACAGAAACGCCTAACAAAAATCGGTTGACCCTTGTGGGGCCTACTCCTGCCAAATTCCACTTCGCACGCGCACGCGCTTTCAGAATATTTGGAAGGA AGCAACGAGGGGCGTTGGTGGCGCTTCATAAGGATATGGAGTCATGTGGGGAGTATACGGATATTCAGGTGATGTGGGAGATGCTGCATTCTTCTAATTG TTCGCCTGGACGACGTCGTGGCGGGAGCCGATCGTCGAGGAAGAAGGTCCCTGGTTGGAGATCTTGTTTCAGGCCTGTTTGTGTTTGA
AA sequence Show only first row Show all	>Lus10002866 pacid=23181317 polypeptide=Lus10002866 locus=Lus10002866.g ID=Lus10002866.BGIv1.0 annot-version=v1.0 MTETPNKNRLTLVGPTPAKFHFARARAFRIFGRKQRGALVALHKDMESCGEYTDIQVMWEMLHSSNCSPGRRRGGSRSSRKKVPGWRSCFRPVCV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002866 [exp]	0	1
AT5G05960			Bifunctional inhibitor/lipid-t...		Lus10009872 [exp]	6.9	0.8777
AT5G46600			Aluminium activated malate tra...		Lus10042571 [exp]	8.5	0.8585
AT4G31680	B3	REM8	Transcriptional factor B3 fami...		Lus10010080 [exp]	14.4	0.8476
AT1G22400		ATUGT85A1, UGT8...	ARABIDOPSIS THALIANA UDP-GLUCO...		Lus10024584 [exp]	17.5	0.8523
AT2G04305			Magnesium transporter CorA-lik...		Lus10010751 [exp]	19.4	0.8741
AT4G09570		CPK4, ATCPK4	calcium-dependent protein kina...		Lus10009427 [exp]	21.8	0.8457
AT4G15760		MO1	monooxygenase 1 (.1.2)		Lus10028081 [exp]	23.5	0.8644
AT3G14920			Peptide-N4-(N-acetyl-beta-gluc...		Lus10025775 [exp]	27.0	0.8699
AT5G24620			Pathogenesis-related thaumatin...		Lus10023896 [exp]	28.5	0.8529
AT2G47180		ATGOLS1	galactinol synthase 1 (.1)		Lus10029145 [exp]	30.1	0.8689

Compare expression of checked genes

Lus10002866 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.