Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18540 100 / 7e-28 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033960 [exp] 144 / 7e-46 AT5G18540 121 / 2e-36 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G216700 [exp] 103 / 3e-29 AT5G18540 141 / 3e-43 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002878 pacid=23176873 polypeptide=Lus10002878 locus=Lus10002878.g ID=Lus10002878.BGIv1.0 annot-version=v1.0 ATGGATGAGTTGAGCGAAGAAGAAAGGAAAGCTCTGAGAGGAAGCAAATTCGCGCCTCTTCCTCCTCCTCCTTCTTCCCGCTCTAACCACCCCAGGTTGG CACACCCTGGGGGACCGTTGAAGACGAACAAAGCAGCGGCACTAGCCAAGTTCCTGGAGAGGAAGCTTCAGGAGCCTAATGGTCTAGACTCCCTCAATCC GGATCTCCTTGAGTTGGCCGTCAAGAACGCCAAGAAAACTGTCTCTTCCGGTGCAGGTTTCACTCCTCTCGTTGTTTTTTCACTCATTTCTATTTGTATA CATATTGCTAGTTCTGGTGGATTTTTGCTTATTGATAATTGGGAACAGCTTGAACTTAGTGCTGAAGAATCAATCTAG
AA sequence Show only first row Show all	>Lus10002878 pacid=23176873 polypeptide=Lus10002878 locus=Lus10002878.g ID=Lus10002878.BGIv1.0 annot-version=v1.0 MDELSEEERKALRGSKFAPLPPPPSSRSNHPRLAHPGGPLKTNKAAALAKFLERKLQEPNGLDSLNPDLLELAVKNAKKTVSSGAGFTPLVVFSLISICI HIASSGGFLLIDNWEQLELSAEESI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18540			unknown protein		Lus10002878 [exp]	0	1
					Lus10032698 [exp]	1.0	0.9059
AT1G09150			pseudouridine synthase and arc...		Lus10015197 [exp]	5.7	0.8929
AT5G38720			unknown protein		Lus10023232 [exp]	5.9	0.8907
AT2G16860			GCIP-interacting family protei...		Lus10027464 [exp]	6.0	0.8956
AT5G45780			Leucine-rich repeat protein ki...		Lus10029241 [exp]	6.8	0.8352
AT2G45520			unknown protein		Lus10015859 [exp]	7.3	0.8884
AT3G17300		EMB2786	unknown protein		Lus10037835 [exp]	9.2	0.8943
AT2G03670		CDC48B	cell division cycle 48B (.1)		Lus10042029 [exp]	11.3	0.8759
AT1G07830			ribosomal protein L29 family p...		Lus10024720 [exp]	17.5	0.8475
AT5G15220			Ribosomal protein L27 family p...		Lus10007170 [exp]	19.4	0.8719

Compare expression of checked genes

Lus10002878 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.