Lus10002881 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 72 / 2e-14 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 59 / 4e-10 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002883 248 / 6e-81 AT5G07900 196 / 9e-59 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 84 / 1e-18 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 84 / 1e-18 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 80 / 5e-17 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 79 / 7e-17 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10016553 74 / 2e-15 AT5G07900 171 / 7e-51 Mitochondrial transcription termination factor family protein (.1)
Lus10016551 68 / 2e-13 AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
Lus10040818 65 / 3e-12 AT5G07900 129 / 2e-34 Mitochondrial transcription termination factor family protein (.1)
Lus10040819 57 / 2e-09 AT5G07900 130 / 2e-35 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G012900 97 / 4e-23 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013100 95 / 2e-22 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012400 91 / 4e-21 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.011G005100 86 / 2e-19 AT5G07900 199 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038500 84 / 1e-18 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013000 84 / 2e-18 AT5G07900 193 / 1e-57 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038400 81 / 1e-17 AT5G07900 237 / 1e-74 Mitochondrial transcription termination factor family protein (.1)
Potri.010G022700 81 / 2e-17 AT5G07900 220 / 5e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.014G133200 81 / 2e-17 AT5G07900 436 / 3e-152 Mitochondrial transcription termination factor family protein (.1)
Potri.012G046700 80 / 3e-17 AT5G07900 241 / 5e-76 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Representative CDS sequence
>Lus10002881 pacid=23176888 polypeptide=Lus10002881 locus=Lus10002881.g ID=Lus10002881.BGIv1.0 annot-version=v1.0
ATGATTGAATCGATAGCAATAGCGGTAGGACGGCGGTTTGGAATTCGCTCGATTTACAGACTTGATCATCTTCCTCAATGTGAGTATCCTCCGTCCTTGA
TCTTACACCTCCGGAGCTTCTCAAGCTCGTTGTCAATTACAGACGACGATGGAAGGTCTGTTACTGTCTCTTCTCTTGTAAACCAGTGTGGCATTTCAAT
AGAGGACGCACTAATTTTATCAGTCTGCCCTAGAATTTTCCGCTCGAGTCTCCAGAATCAGCTGATCCCTTGCTTCCAGTTCTTGGAAGAGTATTACTAT
TCCAAGGATGCAGATATGGCAGCCGTTAAATGCTACCCGCGTATACTGCATTCCAACCTTCATCAGCATGCTGTTCCTGTACTCGAAACGCTACGAGAAG
CTGGAATGCGTAGCAAGTGCATCACTGGGTTCGTCGATCAGCCGTTGAAAAATCGGTGGAAGCCGGAGGTGTTTAGAAGGATGATGGCTGAGGCCACGGG
ATGTCCAACCAACAAAGCTTTCTTTGCAGCTGTCATCTTGCTTACGCATATGAGCAGATCCACATGGGAGAGGAGGCATGCTGCGTATGCCAAATGGGGT
TGGTCTCGGGAACTAGCTATGGATGCGTTCAGAAAATTTCCCAACTGCTTTGCCCTCTCTGTAGAGGAGATTGAAAAAAACGATGGATCTGTTTGTGAAC
AAGTTTGGTTGGAAGTCGTCGTTTGTCGCTAA
AA sequence
>Lus10002881 pacid=23176888 polypeptide=Lus10002881 locus=Lus10002881.g ID=Lus10002881.BGIv1.0 annot-version=v1.0
MIESIAIAVGRRFGIRSIYRLDHLPQCEYPPSLILHLRSFSSSLSITDDDGRSVTVSSLVNQCGISIEDALILSVCPRIFRSSLQNQLIPCFQFLEEYYY
SKDADMAAVKCYPRILHSNLHQHAVPVLETLREAGMRSKCITGFVDQPLKNRWKPEVFRRMMAEATGCPTNKAFFAAVILLTHMSRSTWERRHAAYAKWG
WSRELAMDAFRKFPNCFALSVEEIEKNDGSVCEQVWLEVVVCR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G07900 Mitochondrial transcription te... Lus10002881 0 1
AT5G20890 TCP-1/cpn60 chaperonin family ... Lus10032176 22.6 0.8246
AT5G64950 Mitochondrial transcription te... Lus10029199 37.4 0.8168
AT3G03960 TCP-1/cpn60 chaperonin family ... Lus10007430 48.8 0.8218
AT1G51965 ABO5 ABA Overly-Sensitive 5 (.1) Lus10006850 59.4 0.8008
AT5G06680 ATSPC98, SPC98,... ARABIDOPSIS THALIANA GAMMA TUB... Lus10016246 60.7 0.8016
AT2G26260 AT3BETAHSD/D2 3beta-hydroxysteroid-dehydroge... Lus10010311 74.9 0.7807
AT1G01510 AN ANGUSTIFOLIA, NAD(P)-binding R... Lus10036393 126.2 0.7869
AT5G15610 Proteasome component (PCI) dom... Lus10013192 136.2 0.7580
AT2G46290 Transducin/WD40 repeat-like su... Lus10021857 144.4 0.7828
AT5G41970 Metal-dependent protein hydrol... Lus10008867 177.7 0.7726

Lus10002881 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.