Lus10002883 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G07900 179 / 4e-52 Mitochondrial transcription termination factor family protein (.1)
AT1G21150 170 / 8e-49 Mitochondrial transcription termination factor family protein (.1)
AT1G61980 137 / 3e-36 Mitochondrial transcription termination factor family protein (.1)
AT1G62120 132 / 2e-34 Mitochondrial transcription termination factor family protein (.1)
AT1G61970 127 / 1e-32 Mitochondrial transcription termination factor family protein (.1.2)
AT1G61990 124 / 9e-32 Mitochondrial transcription termination factor family protein (.1)
AT3G46950 125 / 1e-31 Mitochondrial transcription termination factor family protein (.1)
AT1G61960 117 / 5e-29 Mitochondrial transcription termination factor family protein (.1)
AT1G62110 114 / 1e-27 Mitochondrial transcription termination factor family protein (.1)
AT1G62085 110 / 2e-26 Mitochondrial transcription termination factor family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002881 213 / 6e-67 AT5G07900 72 / 1e-14 Mitochondrial transcription termination factor family protein (.1)
Lus10040817 204 / 7e-62 AT5G07900 225 / 6e-70 Mitochondrial transcription termination factor family protein (.1)
Lus10004957 192 / 3e-57 AT5G07900 238 / 4e-75 Mitochondrial transcription termination factor family protein (.1)
Lus10040820 186 / 7e-55 AT5G07900 221 / 2e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10016550 177 / 8e-52 AT5G07900 219 / 9e-68 Mitochondrial transcription termination factor family protein (.1)
Lus10016551 165 / 5e-48 AT5G07900 144 / 3e-40 Mitochondrial transcription termination factor family protein (.1)
Lus10040818 155 / 2e-44 AT5G07900 129 / 2e-34 Mitochondrial transcription termination factor family protein (.1)
Lus10039174 142 / 1e-41 AT1G21150 73 / 2e-16 Mitochondrial transcription termination factor family protein (.1)
Lus10040819 139 / 2e-38 AT5G07900 130 / 2e-35 Mitochondrial transcription termination factor family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G013000 249 / 4e-79 AT5G07900 193 / 1e-57 Mitochondrial transcription termination factor family protein (.1)
Potri.004G013100 244 / 2e-77 AT5G07900 198 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012900 244 / 4e-77 AT5G07900 220 / 6e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.004G012400 242 / 2e-76 AT5G07900 212 / 9e-65 Mitochondrial transcription termination factor family protein (.1)
Potri.010G022700 233 / 3e-73 AT5G07900 220 / 5e-68 Mitochondrial transcription termination factor family protein (.1)
Potri.011G005100 223 / 5e-69 AT5G07900 199 / 1e-59 Mitochondrial transcription termination factor family protein (.1)
Potri.008G216200 218 / 5e-67 AT5G07900 217 / 8e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038400 205 / 4e-62 AT5G07900 237 / 1e-74 Mitochondrial transcription termination factor family protein (.1)
Potri.015G038500 204 / 1e-61 AT5G07900 218 / 2e-67 Mitochondrial transcription termination factor family protein (.1)
Potri.014G133200 200 / 3e-60 AT5G07900 436 / 3e-152 Mitochondrial transcription termination factor family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02536 mTERF mTERF
Representative CDS sequence
>Lus10002883 pacid=23176878 polypeptide=Lus10002883 locus=Lus10002883.g ID=Lus10002883.BGIv1.0 annot-version=v1.0
ATGATTGAATCGATAGCCATAACTTTAGGACGGCGGTTTCGAATTCGCTCGATTTACAGACTTGATCATCTTCCTCAATGTGAGTATCCTCTGTCCTTGT
CATTACACATCCGGCGCTTCTCAAGCTCGTCGTCGATTACAGACGACGAGGGAAAGTCTTTTACAGTCTGTTTCCTTGTAAACAAGTGCGGCATTTCATC
AAAGGAAGCACTAGTAACATCCAAGTATGTTAGCTTGAAAACAGTAGAGACTCCCAACTCGGTACTGAGTTTCTTCAAACGGCATGGTTTCTCGGCCTCC
CAGATTTCAAAAGTCGTGAAGCTACAGCCGAGAGTTCTTCTCTCCCAGCCAATCAAGACTCTTTCCCCCAAGCTGCAATTCCTCCGATCATTGGGATTCT
CCAGCTCAGACGTTGCCCAGATCTTATCGGTCTGCCCTAGAATTTTCCACTCGAGTCTGGAGAATCAGCTGGTCCCTTGCTTCGAGTTCGTCGAAGAGTA
TTATGGTTCGAAAGATGCAGCTGTGGCAGCGGTCAAACGCTGCCCGCGGATGCTGCTTTCCAGCTTTCACCGGCACACTACTCAGGTGCTCGAAACGCTA
CGCCACGCTGGAATTCCTGAAAACTGCATCACTATGTTCGTCCGCAAGCAGTTGACGAACCGATGGAAGCAGGAGAAGCTGAGAAGGATCGTGGCGGATG
TGACCGCAATGGGGATCGATCCAACCAAAACTGCTTTTGTTGCGGCTGTCACTTTGCTCTCGCATGTCAGCAAATCCAATTGGGAGAAGAAGCTTGCTGT
GTATGCGAAATGGGGTTGGTCTCGGGAACTAGCAATGGCTGCGTTTCGAAAATTTCCCAACTGCTTTGCCCACTCTGTAGAGGAGATTGATGGGAAAATG
GATCTGTTTGTGAACAAGTTGGGTTGGGAGCCTTCGTTTGTTGCGAAGAACTCGTCTGTCTTTACGTACAGCTTACGGAGGAGACTCAGGCCGAGGCTAT
TTGTTCTGCAGTTTCTGGTTTCGGAAAGATTGCTCCCTTATGGTTCCGTCTCTCCAAAGCTGAGATTTTTCACCATCGGCGAAAGTGTGTTCATGGAGAA
GTATGTTCTTCCTTATACTGAATCTCATAATCTTTTGGAGTTGTACTTGGAAAAGAAGTCGGAGGGTTTGTTGTCCATTCAAGAGGAGAAAAAGGTTGAC
TGTTAG
AA sequence
>Lus10002883 pacid=23176878 polypeptide=Lus10002883 locus=Lus10002883.g ID=Lus10002883.BGIv1.0 annot-version=v1.0
MIESIAITLGRRFRIRSIYRLDHLPQCEYPLSLSLHIRRFSSSSSITDDEGKSFTVCFLVNKCGISSKEALVTSKYVSLKTVETPNSVLSFFKRHGFSAS
QISKVVKLQPRVLLSQPIKTLSPKLQFLRSLGFSSSDVAQILSVCPRIFHSSLENQLVPCFEFVEEYYGSKDAAVAAVKRCPRMLLSSFHRHTTQVLETL
RHAGIPENCITMFVRKQLTNRWKQEKLRRIVADVTAMGIDPTKTAFVAAVTLLSHVSKSNWEKKLAVYAKWGWSRELAMAAFRKFPNCFAHSVEEIDGKM
DLFVNKLGWEPSFVAKNSSVFTYSLRRRLRPRLFVLQFLVSERLLPYGSVSPKLRFFTIGESVFMEKYVLPYTESHNLLELYLEKKSEGLLSIQEEKKVD
C

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G07900 Mitochondrial transcription te... Lus10002883 0 1
AT1G56110 NOP56 homolog of nucleolar protein N... Lus10021096 11.2 0.8875
AT1G02310 MAN1 endo-beta-mannanase 1, Glycosy... Lus10007211 11.4 0.8193
AT3G59670 unknown protein Lus10008349 15.6 0.8679
AT5G27240 DNAJ heat shock N-terminal dom... Lus10037161 24.1 0.8552
AT3G49990 unknown protein Lus10010625 30.3 0.8395
AT1G04870 PRMT10, ATPRMT1... protein arginine methyltransfe... Lus10019439 33.0 0.8568
AT4G21130 EMB2271 EMBRYO DEFECTIVE 2271, Transdu... Lus10023255 34.2 0.8602
AT2G18900 Transducin/WD40 repeat-like su... Lus10003637 42.9 0.8476
AT3G11830 TCP-1/cpn60 chaperonin family ... Lus10008406 51.6 0.8461
AT1G08130 ATLIG1 DNA ligase 1 (.1) Lus10021418 56.7 0.8432

Lus10002883 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.