Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39220 88 / 6e-23 ATRER1A Rer1 family protein (.1) AT2G18240 87 / 3e-22 Rer1 family protein (.1.2) AT2G21600 79 / 1e-19 ATRER1B endoplasmatic reticulum retrieval protein 1B (.1) AT2G23310 80 / 2e-19 ATRER1C1, ATRER1C Rer1 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041765 [exp] 160 / 8e-51 AT4G39220 250 / 5e-85 Rer1 family protein (.1) Lus10028317 [exp] 155 / 7e-49 AT4G39220 254 / 8e-87 Rer1 family protein (.1) Lus10002890 [exp] 129 / 3e-40 AT4G39220 112 / 7e-33 Rer1 family protein (.1) Lus10028319 [exp] 114 / 4e-33 AT2G21600 249 / 4e-85 endoplasmatic reticulum retrieval protein 1B (.1) Lus10041766 [exp] 114 / 4e-33 AT2G21600 248 / 7e-85 endoplasmatic reticulum retrieval protein 1B (.1) Lus10015498 [exp] 83 / 6e-21 AT4G28040 141 / 5e-41 nodulin MtN21 /EamA-like transporter family protein (.1.2.3.4.5) Lus10011502 [exp] 80 / 1e-19 AT4G39220 258 / 3e-88 Rer1 family protein (.1) Lus10019323 [exp] 79 / 6e-19 AT4G39220 259 / 6e-89 Rer1 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G034200 [exp] 113 / 1e-32 AT2G21600 265 / 3e-91 endoplasmatic reticulum retrieval protein 1B (.1) Potri.005G228900 [exp] 103 / 7e-29 AT2G21600 235 / 1e-79 endoplasmatic reticulum retrieval protein 1B (.1) Potri.009G118500 [exp] 91 / 5e-24 AT4G39220 224 / 2e-75 Rer1 family protein (.1) Potri.004G156900 [exp] 91 / 8e-24 AT4G39220 245 / 1e-83 Rer1 family protein (.1) Potri.007G047800 [exp] 88 / 7e-23 AT4G39220 194 / 3e-63 Rer1 family protein (.1) Potri.005G141700 [exp] 84 / 4e-21 AT2G23310 200 / 2e-65 Rer1 family protein (.1.2) Potri.004G156800 [exp] 70 / 5e-16 AT4G39220 251 / 6e-86 Rer1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03248 [flax] [poplar] Rer1 Rer1 family
Representative CDS sequence Show only first row Show all	>Lus10002889 pacid=23144923 polypeptide=Lus10002889 locus=Lus10002889.g ID=Lus10002889.BGIv1.0 annot-version=v1.0 ATGGCGGAACCGGGAAGTGAAGGCGTCCCCCAGCTCATCAAGTGGAGCAGCGACTTCTCCGGGGTGGTCCAGAACAATCTCAACAGATTGGTGCCTCGGC CGATGCTCAGATCGCTAGGAACCCTTTCTGTGGCGATTCTCTACGTCTTGCGAGTTTACTATGCCCAAGGGTTTTACATCGTCTCCTACGGTCTCGGGAT CTACATTTTGAATCTGCTGATTGGATTTCTGTCCCCTAGGGTTGATCCGGAGTTTGAATCGGTCAATGGACCTTCCCTACTGACGAAGACTTCTGATGAG TTCAATCCTTTTGTTCGCCGACTGCTTGAATTCAAATTCTGCTAG
AA sequence Show only first row Show all	>Lus10002889 pacid=23144923 polypeptide=Lus10002889 locus=Lus10002889.g ID=Lus10002889.BGIv1.0 annot-version=v1.0 MAEPGSEGVPQLIKWSSDFSGVVQNNLNRLVPRPMLRSLGTLSVAILYVLRVYYAQGFYIVSYGLGIYILNLLIGFLSPRVDPEFESVNGPSLLTKTSDE FNPFVRRLLEFKFC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39220		ATRER1A	Rer1 family protein (.1)		Lus10002889 [exp]	0	1
AT4G39220		ATRER1A	Rer1 family protein (.1)		Lus10002890 [exp]	5.1	0.7179
					Lus10040421 [exp]	15.7	0.6640
AT2G15220			Plant basic secretory protein ...		Lus10001358 [exp]	17.7	0.6635
AT4G33985			Protein of unknown function (D...		Lus10027898 [exp]	23.9	0.6488
AT2G21100			Disease resistance-responsive ...		Lus10034473 [exp]	28.3	0.6357
					Lus10017290 [exp]	29.3	0.6354
AT5G46230			Protein of unknown function, D...		Lus10033612 [exp]	32.0	0.6349
AT1G10010		AAP8, ATAAP8	amino acid permease 8 (.1)		Lus10037248 [exp]	37.4	0.6241
					Lus10000085 [exp]	45.5	0.5686
AT1G22440			Zinc-binding alcohol dehydroge...		Lus10009517 [exp]	49.3	0.6218

Compare expression of checked genes

Lus10002889 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.