Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G39220 82 / 4e-21 ATRER1A Rer1 family protein (.1) AT2G21600 74 / 5e-18 ATRER1B endoplasmatic reticulum retrieval protein 1B (.1) AT2G23310 71 / 2e-16 ATRER1C1, ATRER1C Rer1 family protein (.1.2) AT2G18240 68 / 2e-15 Rer1 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002889 [exp] 128 / 3e-40 AT4G39220 119 / 4e-35 Rer1 family protein (.1) Lus10041765 [exp] 107 / 1e-30 AT4G39220 250 / 5e-85 Rer1 family protein (.1) Lus10028317 [exp] 105 / 7e-30 AT4G39220 254 / 8e-87 Rer1 family protein (.1) Lus10028319 [exp] 84 / 8e-22 AT2G21600 249 / 4e-85 endoplasmatic reticulum retrieval protein 1B (.1) Lus10041766 [exp] 84 / 8e-22 AT2G21600 248 / 7e-85 endoplasmatic reticulum retrieval protein 1B (.1) Lus10019323 [exp] 71 / 2e-16 AT4G39220 259 / 6e-89 Rer1 family protein (.1) Lus10011502 [exp] 71 / 2e-16 AT4G39220 258 / 3e-88 Rer1 family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G034200 [exp] 94 / 1e-25 AT2G21600 265 / 3e-91 endoplasmatic reticulum retrieval protein 1B (.1) Potri.005G228900 [exp] 84 / 5e-22 AT2G21600 235 / 1e-79 endoplasmatic reticulum retrieval protein 1B (.1) Potri.009G118500 [exp] 81 / 2e-20 AT4G39220 224 / 2e-75 Rer1 family protein (.1) Potri.004G156900 [exp] 79 / 4e-20 AT4G39220 245 / 1e-83 Rer1 family protein (.1) Potri.007G047800 [exp] 77 / 3e-19 AT4G39220 194 / 3e-63 Rer1 family protein (.1) Potri.005G141700 [exp] 72 / 2e-17 AT2G23310 200 / 2e-65 Rer1 family protein (.1.2) Potri.004G156800 [exp] 62 / 2e-13 AT4G39220 251 / 6e-86 Rer1 family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03248 [flax] [poplar] Rer1 Rer1 family
Representative CDS sequence Show only first row Show all	>Lus10002890 pacid=23144928 polypeptide=Lus10002890 locus=Lus10002890.g ID=Lus10002890.BGIv1.0 annot-version=v1.0 ATGCTCAGATCGCTAGGAACCCTTTCTGTGGCGATTCTCTACGTCTTGCGAGTTTACTATGCCCAAGGGTTTTACATCGTCTCCTACGGTCTCGGGATCT ACATTTTGAATCTGCTGATTGGATTTCTGTCCCCTAGGGTTGATCCGGAGTTTGAATCGGTCAATGGACCTTCCCTACTGACGAAGACTTCTGATGAGTT CAATCCTTTTGTTCGCCGACTGCTTGAATTCAAATTCTGCTAG
AA sequence Show only first row Show all	>Lus10002890 pacid=23144928 polypeptide=Lus10002890 locus=Lus10002890.g ID=Lus10002890.BGIv1.0 annot-version=v1.0 MLRSLGTLSVAILYVLRVYYAQGFYIVSYGLGIYILNLLIGFLSPRVDPEFESVNGPSLLTKTSDEFNPFVRRLLEFKFC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G39220		ATRER1A	Rer1 family protein (.1)		Lus10002890 [exp]	0	1
AT4G30320			CAP (Cysteine-rich secretory p...		Lus10015522 [exp]	1.4	0.7898
AT4G39220		ATRER1A	Rer1 family protein (.1)		Lus10002889 [exp]	5.1	0.7179
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10000678 [exp]	6.9	0.7383
AT4G37870		PCK1, PEPCK	phosphoenolpyruvate carboxykin...		Lus10019242 [exp]	18.2	0.7548
AT4G00120	bHLH	IND1, GT140, bH...	INDEHISCENT, EMBRYO SAC DEVELO...		Lus10033488 [exp]	20.4	0.6480
AT2G21100			Disease resistance-responsive ...		Lus10034473 [exp]	22.7	0.7437
AT3G50845			Protein of unknown function (D...		Lus10014311 [exp]	24.8	0.7451
AT1G75560			zinc knuckle (CCHC-type) famil...		Lus10035476 [exp]	27.4	0.7532
AT4G33985			Protein of unknown function (D...		Lus10027898 [exp]	28.3	0.7359
AT5G20550			2-oxoglutarate (2OG) and Fe(II...		Lus10016145 [exp]	31.4	0.7320

Compare expression of checked genes

Lus10002890 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.