Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74400 105 / 3e-27 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G15130 104 / 1e-26 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G21065 99 / 5e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT5G08305 99 / 5e-25 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G66520 99 / 8e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G29230 97 / 3e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G08820 97 / 4e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G62890 96 / 7e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G14850 95 / 2e-23 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G49142 95 / 3e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002024 [exp] 225 / 1e-72 AT5G56310 344 / 6e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10023592 [exp] 108 / 5e-28 AT1G74630 840 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10013319 [exp] 105 / 7e-27 AT4G21065 744 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10005207 [exp] 105 / 7e-27 AT4G21065 741 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10016387 [exp] 102 / 4e-26 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10000117 [exp] 101 / 4e-26 AT4G21065 404 / 5e-139 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10019735 [exp] 102 / 7e-26 AT4G33990 1015 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10039388 [exp] 102 / 1e-25 AT5G43790 506 / 8e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10006628 [exp] 100 / 2e-25 AT4G21065 399 / 7e-137 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G252400 [exp] 170 / 2e-51 AT4G21065 496 / 8e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.017G001000 [exp] 108 / 6e-28 AT4G21065 793 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.017G086100 [exp] 103 / 2e-26 AT5G15300 675 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.014G068800 [exp] 103 / 3e-26 AT2G45350 735 / 0.0 CHLORORESPIRATORY REDUCTION 4, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G244500 [exp] 100 / 2e-25 AT3G15130 891 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.010G168800 [exp] 100 / 3e-25 AT2G02980 860 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 85, Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G035900 [exp] 99 / 9e-25 AT1G74630 884 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.016G051300 [exp] 98 / 2e-24 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.003G223900 [exp] 97 / 4e-24 AT5G56310 508 / 1e-176 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.004G237000 [exp] 97 / 5e-24 AT5G66520 544 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10002903 pacid=23148610 polypeptide=Lus10002903 locus=Lus10002903.g ID=Lus10002903.BGIv1.0 annot-version=v1.0 ATGAGGAATTACCTTCCCAAATCGAACAGGGTACCCTCTTCAGTTCCTTGGAACAAGTCTTCAATAGAAGCTGCTGCAGAACACACCAGACAGCAATGTA TGGTTGATTTGTTTTGCAGGGCGGGGATGGTTAAAGAGGCGTCTGAGTTTGTTCGAGAGATGCCGGTTGAGCCGAACCCGATCATTTGGCGGACTCTGAT CAATGCCTGTCGATGTAATGGAGAGTTGAAGCTTGGAGAGGAGATTAGTGCAAAGCTTATGAGGAATGATCCAAAGTATGAGTCCAACTATGTGACGCTT TCGAACATTTATGCGAAAATGTCGGAGTGGGAGAAGAAGAGAAGTGTTCGAGAGGCGATGGATGTGCAGGGGATGCGGAAGATTGCTGGAAGCACTAAGA TTGAGTTGGAACGTGGTTCAGATTCGGCTCAAATTGAACTCGTCGGAAGGTTTTAG
AA sequence Show only first row Show all	>Lus10002903 pacid=23148610 polypeptide=Lus10002903 locus=Lus10002903.g ID=Lus10002903.BGIv1.0 annot-version=v1.0 MRNYLPKSNRVPSSVPWNKSSIEAAAEHTRQQCMVDLFCRAGMVKEASEFVREMPVEPNPIIWRTLINACRCNGELKLGEEISAKLMRNDPKYESNYVTL SNIYAKMSEWEKKRSVREAMDVQGMRKIAGSTKIELERGSDSAQIELVGRF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74400			Tetratricopeptide repeat (TPR)...		Lus10002903 [exp]	0	1
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10018547 [exp]	4.6	0.8050
AT4G21440	MYB	ATMYB102, ATM4	A. THALIANA MYB 4, MYB-like 10...		Lus10033737 [exp]	6.0	0.7637
AT1G60030		ATNAT7	ARABIDOPSIS NUCLEOBASE-ASCORBA...		Lus10005717 [exp]	7.3	0.7922
AT5G16080		ATCXE17	carboxyesterase 17 (.1)		Lus10017587 [exp]	13.4	0.7282
AT2G22590			UDP-Glycosyltransferase superf...		Lus10043446 [exp]	14.0	0.7588
AT3G56400	WRKY	ATWRKY70, WRKY7...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10025133 [exp]	20.4	0.7586
AT1G15380		GLYI4	glyoxylase I 4, Lactoylglutath...		Lus10025971 [exp]	29.5	0.7430
AT1G64760			O-Glycosyl hydrolases family 1...		Lus10020526 [exp]	30.8	0.7210
					Lus10005269 [exp]	30.9	0.6148
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10011435 [exp]	33.2	0.6848

Compare expression of checked genes

Lus10002903 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.