Lus10002906 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G47650 110 / 9e-32 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002020 124 / 5e-38 AT3G47650 90 / 7e-25 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10019417 117 / 3e-34 AT3G47650 128 / 2e-38 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10005719 115 / 5e-34 AT3G47650 130 / 4e-40 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10030091 114 / 1e-33 AT3G47650 129 / 3e-39 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10043274 92 / 1e-24 AT3G47650 107 / 1e-30 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10026899 45 / 2e-06 AT2G24860 154 / 6e-49 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10001328 43 / 1e-05 AT5G17840 143 / 3e-44 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Lus10024330 38 / 0.0006 AT1G75690 164 / 1e-52 LOW QUANTUM YIELD OF PHOTOSYSTEM II 1, DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G028500 129 / 1e-39 AT3G47650 120 / 4e-36 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.018G068300 118 / 3e-35 AT3G47650 140 / 9e-44 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.018G016400 47 / 3e-07 AT2G24860 165 / 5e-53 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.006G266800 44 / 4e-06 AT2G24860 167 / 3e-54 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.013G066000 41 / 5e-05 AT5G17840 145 / 4e-45 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
Potri.019G040400 40 / 7e-05 AT5G17840 145 / 4e-45 DnaJ/Hsp40 cysteine-rich domain superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10002906 pacid=23148589 polypeptide=Lus10002906 locus=Lus10002906.g ID=Lus10002906.BGIv1.0 annot-version=v1.0
ATGGCTGCAGTGGCGAGCTCTAATATGGCGCTCTCCGTTCCATATCCAGTGACATATACAGTACAGCTGAGTTCATCGCTGGGAAGTAAGCAGGAAAGCC
ATGGCGGCCTGCAGAAAGCTTCAATTACCAGTAGAAGAAGAAGGTTTATCCGTTTGAAAGCCCAGGCTGCAGAAGAAAATCAAGTCCCGAAACGGAAGAG
TGTGATATGCTCTGACTGTGATGGAAATGGTGCTGTTCAGTGCTCACAGTGCAAAGGCAATGGTGTAAACCCAGTTGATTTCTTCAATGGGCAGTTCAAA
GCTGGCGATTCGTGTTGGCTTTGCGGGGGGAAGAAAGATATGTTATGTGGGAACTGCAATGGAGCTGGATTCCTTGGTGGCTTTATCAGCACTGGTGATC
AGTGA
AA sequence
>Lus10002906 pacid=23148589 polypeptide=Lus10002906 locus=Lus10002906.g ID=Lus10002906.BGIv1.0 annot-version=v1.0
MAAVASSNMALSVPYPVTYTVQLSSSLGSKQESHGGLQKASITSRRRRFIRLKAQAAEENQVPKRKSVICSDCDGNGAVQCSQCKGNGVNPVDFFNGQFK
AGDSCWLCGGKKDMLCGNCNGAGFLGGFISTGDQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G47650 DnaJ/Hsp40 cysteine-rich domai... Lus10002906 0 1
AT1G12250 Pentapeptide repeat-containing... Lus10024602 1.0 0.9607
AT2G03420 unknown protein Lus10036810 1.4 0.9592
AT3G29185 Domain of unknown function (DU... Lus10032999 2.6 0.9398
AT4G26555 FKBP-like peptidyl-prolyl cis-... Lus10027129 2.8 0.9483
AT1G74880 NdhO, NDH-O NADH dehydrogenase-like comple... Lus10000828 4.2 0.9516
AT5G38510 Rhomboid-related intramembrane... Lus10000628 6.8 0.9242
AT1G79040 PSBR photosystem II subunit R (.1) Lus10042461 8.7 0.9451
AT1G07700 Thioredoxin superfamily protei... Lus10032343 10.1 0.9400
AT1G51110 Plastid-lipid associated prote... Lus10012100 12.4 0.9299
AT3G16250 PnsB3, NDF4 Photosynthetic NDH subcomplex... Lus10025809 13.4 0.9372

Lus10002906 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.