Lus10002911 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G15370 253 / 5e-88 SNARE-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002016 298 / 7e-106 AT1G15370 253 / 7e-88 SNARE-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G193100 246 / 2e-85 AT1G15370 263 / 7e-92 SNARE-like superfamily protein (.1)
Potri.006G253700 213 / 3e-72 AT1G15370 197 / 4e-66 SNARE-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0431 PF PF01217 Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence
>Lus10002911 pacid=23148613 polypeptide=Lus10002911 locus=Lus10002911.g ID=Lus10002911.BGIv1.0 annot-version=v1.0
ATGTTGCTCGCAGTTCTCATCTCGAATTCGGTGGGCAATATTCTCGTGGAAAGATTCAATGGAGTTCCAGCTGAGGAGCGATTGCACTGGCGATCTTTCC
TGGTGAAACTGGGAGCTGACAATCTCAAGCACGCCAAGAACGAAGAACTCTTCGTTGCTTCCCACAAGTCAGTTTATATCGTGTATACGGTGCTGGGAGA
TATCTGCCTTTACGTTGTTGGCAAGGATGAATATGATGAACTAGCTTTGTCTGAAGCCATCTTTGTGATAACGGGATCGATCAAGGATATCTGCAAGAAG
CCTCCGACGGAGCGGACTTTCCTCGATAAGTATGGGAAGATATGTCTGTCCCTCGATGAAATCGTCTGGAAGGGGATCCTGGAGAACACAGACAAAGACA
GGATCAAAAGGCTGATTAGATTGAAGCCTCCAACAGATGTTTGA
AA sequence
>Lus10002911 pacid=23148613 polypeptide=Lus10002911 locus=Lus10002911.g ID=Lus10002911.BGIv1.0 annot-version=v1.0
MLLAVLISNSVGNILVERFNGVPAEERLHWRSFLVKLGADNLKHAKNEELFVASHKSVYIVYTVLGDICLYVVGKDEYDELALSEAIFVITGSIKDICKK
PPTERTFLDKYGKICLSLDEIVWKGILENTDKDRIKRLIRLKPPTDV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G15370 SNARE-like superfamily protein... Lus10002911 0 1
AT3G46010 ATADF1, ADF1 actin depolymerizing factor 1 ... Lus10024417 3.0 0.8433
AT2G45200 ATGOS12, GOS12 golgi snare 12 (.1.2) Lus10030294 3.5 0.8375
AT3G60340 alpha/beta-Hydrolases superfam... Lus10028200 3.6 0.7880
AT3G24160 PMP putative type 1 membrane prote... Lus10000760 4.0 0.8361
AT3G60820 PBF1 N-terminal nucleophile aminohy... Lus10000062 5.4 0.7627
AT4G32530 ATPase, F0/V0 complex, subunit... Lus10000694 6.5 0.8406
AT2G46000 unknown protein Lus10017790 7.1 0.7818
AT5G54750 Transport protein particle (TR... Lus10028720 7.3 0.8140
AT5G59613 unknown protein Lus10040848 7.9 0.7374
AT5G35080 unknown protein Lus10008819 8.1 0.8259

Lus10002911 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.