Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G32280 45 / 5e-06 AUX_IAA IAA29 indole-3-acetic acid inducible 29 (.1) AT4G14550 43 / 4e-05 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) AT2G33310 42 / 6e-05 AUX_IAA IAA13 auxin-induced protein 13 (.1.2.3) AT4G28640 41 / 0.0001 AUX_IAA IAA11 indole-3-acetic acid inducible 11 (.1.2.3) AT1G80390 40 / 0.0001 AUX_IAA IAA15 indole-3-acetic acid inducible 15 (.1) AT3G23030 40 / 0.0003 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1) AT2G22670 40 / 0.0004 AUX_IAA IAA8 indoleacetic acid-induced protein 8 (.1.2.3.4) AT5G65670 40 / 0.0004 AUX_IAA IAA9 indole-3-acetic acid inducible 9 (.1.2) AT1G04250 40 / 0.0004 AUX_IAA IAA17, AXR3 indole-3-acetic acid inducible 17, AUXIN RESISTANT 3, AUX/IAA transcriptional regulator family protein (.1) AT4G14560 39 / 0.0007 AUX_IAA AXR5, IAA1 AUXIN RESISTANT 5, indole-3-acetic acid inducible (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001501 [exp] 241 / 2e-82 AT1G04100 81 / 9e-19 indoleacetic acid-induced protein 10 (.1) Lus10039487 [exp] 46 / 4e-06 AT4G14550 232 / 5e-77 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Lus10039414 [exp] 44 / 2e-05 AT4G14550 305 / 1e-105 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Lus10019241 [exp] 42 / 7e-05 AT5G65670 356 / 4e-123 indole-3-acetic acid inducible 9 (.1.2) Lus10011583 [exp] 42 / 8e-05 AT5G65670 333 / 2e-114 indole-3-acetic acid inducible 9 (.1.2) Lus10014731 [exp] 42 / 0.0001 AT3G04730 241 / 4e-80 indoleacetic acid-induced protein 16 (.1) Lus10002724 [exp] 42 / 0.0001 AT3G23050 212 / 5e-68 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2) Lus10034962 [exp] 41 / 0.0002 AT4G29080 289 / 4e-97 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) Lus10015907 [exp] 40 / 0.0004 AT3G04730 309 / 5e-107 indoleacetic acid-induced protein 16 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G255200 [exp] 61 / 1e-11 AT4G32280 137 / 7e-40 indole-3-acetic acid inducible 29 (.1) Potri.005G218300 [exp] 45 / 7e-06 AT4G14550 292 / 7e-101 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.018G127800 [exp] 44 / 1e-05 AT1G04550 94 / 2e-23 indole-3-acetic acid inducible 12, BODENLOS, AUX/IAA transcriptional regulator family protein (.1.2) Potri.006G066600 [exp] 44 / 2e-05 AT4G28640 104 / 3e-27 indole-3-acetic acid inducible 11 (.1.2.3) Potri.008G161200 [exp] 42 / 5e-05 AT4G14550 343 / 1e-120 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.002G256600 [exp] 42 / 7e-05 AT4G28640 191 / 6e-60 indole-3-acetic acid inducible 11 (.1.2.3) Potri.010G078300 [exp] 42 / 0.0001 AT4G14550 319 / 1e-110 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.010G065200 [exp] 41 / 0.0002 AT2G33310 243 / 4e-80 auxin-induced protein 13 (.1.2.3) Potri.003G048100 [exp] 41 / 0.0002 AT3G16500 224 / 4e-72 indole-3-acetic acid inducible 26, phytochrome-associated protein 1 (.1) Potri.013G041400 [exp] 41 / 0.0002 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02309 [flax] [poplar] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Lus10002921 pacid=23148595 polypeptide=Lus10002921 locus=Lus10002921.g ID=Lus10002921.BGIv1.0 annot-version=v1.0 ATGGAGCTTGAACTCGGTCTCTCTCTCCCGCCGGCCACGTTGGAACTTAACGGCGCCGTCAACCAGTTTGAGAAGTGGTCGGATTCCTGTTTGAAGAACA AAACAAATAGATACTACGAGGATAATGGTGCCACTCCTCATCATGATGACGACAGCTGCCTCGTAGACGATGAAACGACGTCGTCTGCAGGAACAATGAC GACGCTGCCGTTGTTTGTGTGGAGTGGGCGGCGGCCACCCGAGGACGACCAAGACAACACCTCTAAGGGCTGCCGCAGCAGATTCGTGAAGGTGAAAATG GCCGGGGAGGCCATCATTCGAAAGATCGACCTCAACCGTTATGATTCGTATCATTCTCTTACACGCTCCCTTCTTCATATGTTTGCTAAATGTGGTACGT CTTTATTCATGCTTAAGAGGATGGTACCGCGTATGGAGATACTGAGGACAAGTGATGGCCGGCTAACTAGCAATGGACCATTGAAGGCGACGCATAGTCG GTAG
AA sequence Show only first row Show all	>Lus10002921 pacid=23148595 polypeptide=Lus10002921 locus=Lus10002921.g ID=Lus10002921.BGIv1.0 annot-version=v1.0 MELELGLSLPPATLELNGAVNQFEKWSDSCLKNKTNRYYEDNGATPHHDDDSCLVDDETTSSAGTMTTLPLFVWSGRRPPEDDQDNTSKGCRSRFVKVKM AGEAIIRKIDLNRYDSYHSLTRSLLHMFAKCGTSLFMLKRMVPRMEILRTSDGRLTSNGPLKATHSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002921 [exp]	0	1
AT5G64440		ATFAAH	fatty acid amide hydrolase (.1...		Lus10020469 [exp]	3.5	0.9620
AT3G60720		PDLP8	plasmodesmata-located protein ...		Lus10011894 [exp]	4.9	0.9593
AT1G64960		HEB1	hypersensitive to excess boron...		Lus10025197 [exp]	8.8	0.9548
AT2G38750		ANNAT4	annexin 4 (.1)		Lus10039551 [exp]	8.9	0.9614
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10031145 [exp]	12.4	0.9704
AT1G29010			unknown protein		Lus10013688 [exp]	12.6	0.9506
AT5G47540			Mo25 family protein (.1)		Lus10036523 [exp]	16.7	0.9689
AT4G35150			O-methyltransferase family pro...		Lus10017699 [exp]	22.6	0.9641
AT5G51780	bHLH	bHLH036	basic helix-loop-helix (bHLH) ...		Lus10027395 [exp]	32.2	0.9401
AT5G44120		ATCRA1, CRU1, C...	CRUCIFERINA, RmlC-like cupins ...		Lus10011817 [exp]	32.8	0.9604

Compare expression of checked genes

Lus10002921 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.