Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62510 87 / 6e-23 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12470 84 / 2e-21 AZI1 azelaic acid induced 1 (.1) AT1G12090 83 / 3e-21 ELP extensin-like protein (.1) AT4G12510 82 / 3e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12520 82 / 3e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46890 82 / 7e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT2G45180 82 / 7e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT5G46900 81 / 1e-20 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G12480 81 / 2e-20 PEARLI 1 1, PEARLI 1, pEARLI1 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) AT4G00165 78 / 2e-19 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001493 [exp] 132 / 5e-41 AT1G62510 111 / 2e-32 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10006191 [exp] 96 / 3e-26 AT1G62510 103 / 5e-29 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10041036 [exp] 94 / 1e-25 AT1G62510 102 / 1e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024626 [exp] 88 / 5e-23 AT4G12520 157 / 7e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10024625 [exp] 87 / 5e-23 AT4G12520 158 / 5e-51 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10004348 [exp] 87 / 8e-23 AT4G12520 154 / 4e-49 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Lus10032253 [exp] 87 / 1e-22 ND 139 / 2e-43 Lus10032261 [exp] 87 / 1e-22 AT4G12470 157 / 9e-50 azelaic acid induced 1 (.1) Lus10032254 [exp] 86 / 1e-22 AT4G12520 139 / 3e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G025900 [exp] 95 / 4e-26 AT2G45180 127 / 8e-39 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G256100 [exp] 90 / 4e-24 AT2G45180 116 / 2e-34 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G158400 [exp] 87 / 8e-23 AT1G62510 132 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.003G111400 [exp] 82 / 4e-21 AT1G62510 93 / 7e-25 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.001G121900 [exp] 82 / 6e-21 AT1G62510 99 / 5e-27 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.014G059800 [exp] 81 / 9e-21 AT4G00165 127 / 1e-38 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2) Potri.001G121800 [exp] 79 / 1e-19 AT1G12100 143 / 5e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.006G008500 [exp] 71 / 2e-16 AT3G22120 80 / 6e-18 cell wall-plasma membrane linker protein (.1) Potri.006G008300 [exp] 69 / 4e-15 AT3G22142 113 / 2e-28 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1) Potri.013G128800 [exp] 63 / 2e-13 AT4G12480 109 / 5e-31 EARLY ARABIDOPSIS ALUMINUM INDUCED 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0482 [flax] [poplar] Prolamin PF00234 [flax] [poplar] Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence Show only first row Show all	>Lus10002927 pacid=23148596 polypeptide=Lus10002927 locus=Lus10002927.g ID=Lus10002927.BGIv1.0 annot-version=v1.0 ATGGCCGCCACCAAACTCCACGCCATCATCCTAATAACAAACCTCCTCCTCTTCTTCTCCTCCACCGCCACCGCCACTTGCCCGCCGGCTCCTGCAGCAC CAGCACCGTCGTCGCCGCCGCCGGCAAAGTGCCCGAGGGACACGCTGAAGCTAGGGGCCTGCGTGGACCTGCTAGGCGGGCTGGTTCACTTGGTGGTGGG GACGCCTCCTTCGAGTGAGTGTTGCGCGTTGATCAAAGGACTCGCTGACCTGGAAGCCGCGCTGTGTTTATGTACAGTCATCAAGGCCAACGTTCTCGGG ATTAATCTCACCGTGCCGCTAGCTCTCAGCTTGCTCCTCTCCGCCTGTGAGAAGACCGTCCCTCCTGGCTTCAAGTGTTGA
AA sequence Show only first row Show all	>Lus10002927 pacid=23148596 polypeptide=Lus10002927 locus=Lus10002927.g ID=Lus10002927.BGIv1.0 annot-version=v1.0 MAATKLHAIILITNLLLFFSSTATATCPPAPAAPAPSSPPPAKCPRDTLKLGACVDLLGGLVHLVVGTPPSSECCALIKGLADLEAALCLCTVIKANVLG INLTVPLALSLLLSACEKTVPPGFKC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62510			Bifunctional inhibitor/lipid-t...		Lus10002927 [exp]	0	1
AT4G26530			Aldolase superfamily protein (...		Lus10005849 [exp]	2.8	0.9107
AT5G67090			Subtilisin-like serine endopep...		Lus10009748 [exp]	4.2	0.9056
AT2G23180		CYP96A1	"cytochrome P450, family 96, s...		Lus10025677 [exp]	8.1	0.8958
AT4G31940		CYP82C4	"cytochrome P450, family 82, s...		Lus10007837 [exp]	9.5	0.8714
AT1G70580		GGT2, AOAT2	GLUTAMATE:GLYOXYLATE AMINOTRAN...		Lus10026692 [exp]	15.5	0.8546
AT1G70580		GGT2, AOAT2	GLUTAMATE:GLYOXYLATE AMINOTRAN...		Lus10004623 [exp]	16.1	0.8325
AT1G32060		PRK	phosphoribulokinase (.1)		Lus10011060 [exp]	18.3	0.8917
AT4G26530			Aldolase superfamily protein (...		Lus10032956 [exp]	20.3	0.8586
AT5G42760			Leucine carboxyl methyltransfe...		Lus10000713 [exp]	22.3	0.8632
AT1G47480			alpha/beta-Hydrolases superfam...		Lus10019884 [exp]	22.6	0.8612

Compare expression of checked genes

Lus10002927 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.