Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021481 [exp] 75 / 2e-17 AT4G14180 904 / 0.0 putative recombination initiation defect 1 (.1) Lus10022584 [exp] 75 / 3e-17 AT4G14180 602 / 0.0 putative recombination initiation defect 1 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002928 pacid=23164955 polypeptide=Lus10002928 locus=Lus10002928.g ID=Lus10002928.BGIv1.0 annot-version=v1.0 ATGATTAAACGAGCCGAGCTCAAGCCCGGTAAAAGTTCGACTCGACTCGTATGCAGCTCTACTTCCAAGGCATGTCAATATTTTCCTCCTTCCAGCCACG ACTATCCCCACCCTGGCGACGAAGAATCTTCTGGCCTTCTGTTAGCTTTCTCCTCAAAGTTCTGGCGGTTTTCACTCAATGTCCTTTTGAAAACCCAGAA TGACACTTTTCGCCTCAACTCTCTAGGTTTTATTACTTTACCTCCTTTCTGA
AA sequence Show only first row Show all	>Lus10002928 pacid=23164955 polypeptide=Lus10002928 locus=Lus10002928.g ID=Lus10002928.BGIv1.0 annot-version=v1.0 MIKRAELKPGKSSTRLVCSSTSKACQYFPPSSHDYPHPGDEESSGLLLAFSSKFWRFSLNVLLKTQNDTFRLNSLGFITLPPF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002928 [exp]	0	1
AT3G12440			Polynucleotidyl transferase, r...		Lus10000103 [exp]	2.4	0.9740
AT3G02260		CRM1, TIR3, LPR...	UMBRELLA 1, TRANSPORT INHIBITO...		Lus10000087 [exp]	7.6	0.9604
AT3G02260		CRM1, TIR3, LPR...	UMBRELLA 1, TRANSPORT INHIBITO...		Lus10005090 [exp]	10.2	0.9477
AT1G33060	NAC	ANAC014	NAC 014 (.1.2)		Lus10008240 [exp]	10.8	0.9373
AT2G28290		CHR3, SYD	SPLAYED, CHROMATIN REMODELING ...		Lus10033980 [exp]	11.8	0.9515
AT5G18140			Chaperone DnaJ-domain superfam...		Lus10005699 [exp]	12.5	0.9415
AT5G24740			Protein of unknown function (D...		Lus10003835 [exp]	12.7	0.9516
ATMG00650		ATMG00650.1, NA...	NADH dehydrogenase subunit 4L ...		Lus10004838 [exp]	13.7	0.9461
AT3G02260		CRM1, TIR3, LPR...	UMBRELLA 1, TRANSPORT INHIBITO...		Lus10034360 [exp]	16.6	0.9474
AT1G21630			Calcium-binding EF hand family...		Lus10035983 [exp]	18.5	0.9239

Compare expression of checked genes

Lus10002928 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.