Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G47960 87 / 2e-21 ATC/VIF1, C/VIF1 cell wall / vacuolar inhibitor of fructosidase 1 (.1) AT3G17152 78 / 3e-18 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17130 58 / 1e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17150 57 / 2e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT3G17140 56 / 2e-10 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G64620 50 / 1e-07 ATC/VIF2, C/VIF2 cell wall / vacuolar inhibitor of fructosidase 2 (.1) AT3G49330 45 / 5e-06 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46930 44 / 1e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) AT5G46970 40 / 0.0002 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003530 [exp] 320 / 2e-113 AT1G47960 91 / 5e-23 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016318 [exp] 90 / 6e-23 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016317 [exp] 85 / 8e-21 AT1G47960 115 / 2e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10027947 [exp] 77 / 1e-17 AT1G47960 111 / 1e-30 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10000822 [exp] 75 / 6e-17 AT1G47960 113 / 1e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10037791 [exp] 74 / 1e-16 AT3G17130 131 / 8e-39 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10017074 [exp] 71 / 3e-15 AT3G17130 121 / 8e-35 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Lus10017013 [exp] 69 / 6e-15 AT1G47960 112 / 4e-31 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Lus10016319 [exp] 69 / 9e-15 AT3G17130 151 / 8e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G083500 [exp] 167 / 4e-53 AT1G47960 114 / 7e-32 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.010G063000 [exp] 118 / 7e-34 AT1G47960 137 / 3e-41 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.001G288500 [exp] 81 / 7e-20 AT1G47960 59 / 1e-11 cell wall / vacuolar inhibitor of fructosidase 1 (.1) Potri.008G102600 [exp] 81 / 2e-19 AT3G17130 153 / 1e-47 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.001G127500 [exp] 58 / 7e-11 AT4G02250 98 / 3e-26 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.010G209800 [exp] 56 / 7e-10 AT5G64620 93 / 5e-24 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.007G108301 [exp] 56 / 8e-10 AT5G64620 163 / 1e-51 cell wall / vacuolar inhibitor of fructosidase 2 (.1) Potri.004G016500 [exp] 54 / 3e-09 AT4G02250 73 / 2e-16 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.007G068300 [exp] 54 / 4e-09 AT4G00872 113 / 4e-32 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1) Potri.003G122000 [exp] 52 / 2e-08 AT5G64620 53 / 7e-09 cell wall / vacuolar inhibitor of fructosidase 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04043 [flax] [poplar] PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence Show only first row Show all	>Lus10002933 pacid=23164967 polypeptide=Lus10002933 locus=Lus10002933.g ID=Lus10002933.BGIv1.0 annot-version=v1.0 ATGTTGAGGAAGGTAAGCATAGTCGTGGTACTCACAATTTACCATGTGGCAGCAACAAGACCAATCCCAAACATCCAGAGAAACAACCTCATCGACAAAG TCTGCAAACGATCACCATACTACGAGCTATGCATCCAAACCTTGGTTTCGAATCCGGAGAGCTTCCACAGCAATGTGGAAGGCCTAGCCAAGATCACAGT GGGGGGAATTGCAGACAAGGCAACCACTGCCCTCCACAGGATAGAAAAGATATTGGAAACGAGGGAGTTGAAGCCAAGTGTAAGGGATGCATTAGATGGA TGTGCTGAGAGGTACCACGCTGTGATTGAGCAAGATGTTCCGGAGACACTTAGATCACTGACAACTGGAAACTACAAGTTTGCAGCCAGAGGGACTAATG ATGCTGCCCAGGAGGCCATGTCTTGTGAGGAGGATTTCGCAGCAGGGGAGTCGCCATTGTCGGATTTGAACATGGTGGTTCATGACATATCTGTTGTGGC TGCTGCCGTTGTTCAGGCCGTTATAGAGAGTTGA
AA sequence Show only first row Show all	>Lus10002933 pacid=23164967 polypeptide=Lus10002933 locus=Lus10002933.g ID=Lus10002933.BGIv1.0 annot-version=v1.0 MLRKVSIVVVLTIYHVAATRPIPNIQRNNLIDKVCKRSPYYELCIQTLVSNPESFHSNVEGLAKITVGGIADKATTALHRIEKILETRELKPSVRDALDG CAERYHAVIEQDVPETLRSLTTGNYKFAARGTNDAAQEAMSCEEDFAAGESPLSDLNMVVHDISVVAAAVVQAVIES

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G47960		ATC/VIF1, C/VIF...	cell wall / vacuolar inhibitor...		Lus10002933 [exp]	0	1
					Lus10043307 [exp]	2.6	0.9731
					Lus10015828 [exp]	2.8	0.9846
					Lus10002418 [exp]	3.6	0.9627
AT3G02750			Protein phosphatase 2C family ...		Lus10022683 [exp]	4.0	0.9533
AT5G15430			Plant calmodulin-binding prote...		Lus10003472 [exp]	4.2	0.9826
AT5G03610			GDSL-like Lipase/Acylhydrolase...		Lus10028145 [exp]	4.9	0.9815
AT1G11340			S-locus lectin protein kinase ...		Lus10036139 [exp]	6.0	0.9781
AT2G03200			Eukaryotic aspartyl protease f...		Lus10022917 [exp]	6.7	0.9773
AT5G15430			Plant calmodulin-binding prote...		Lus10000141 [exp]	8.1	0.9745
AT3G61150	HD	HD-GL2-1, HDG1	HOMEODOMAIN-GLABRA2 1, homeodo...		Lus10011633 [exp]	8.2	0.9502

Compare expression of checked genes

Lus10002933 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.