Lus10002938 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48240 131 / 8e-39 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G63130 122 / 3e-35 Octicosapeptide/Phox/Bem1p family protein (.1)
AT3G26510 102 / 2e-27 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
AT1G70640 99 / 4e-26 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1)
AT5G49920 76 / 1e-16 Octicosapeptide/Phox/Bem1p family protein (.1)
AT3G46920 76 / 6e-16 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT4G05150 74 / 1e-15 Octicosapeptide/Phox/Bem1p family protein (.1)
AT1G79570 73 / 3e-15 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT2G35050 73 / 4e-15 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT5G57610 73 / 4e-15 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10043341 131 / 1e-38 AT3G48240 145 / 2e-44 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10019490 127 / 4e-37 AT3G48240 149 / 9e-46 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10026700 103 / 1e-27 AT3G26510 135 / 3e-40 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10017947 94 / 1e-24 AT5G63130 121 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10006214 84 / 3e-20 AT3G26510 123 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10036862 84 / 4e-20 AT3G26510 122 / 3e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10002588 84 / 8e-19 AT4G05150 319 / 2e-104 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10035641 78 / 1e-17 AT5G09620 243 / 6e-78 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10040006 77 / 1e-16 AT3G46920 604 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G083400 139 / 6e-42 AT3G48240 152 / 2e-47 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.012G085000 137 / 3e-41 AT5G63130 139 / 4e-42 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.008G186500 113 / 2e-31 AT3G26510 152 / 1e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.010G046400 104 / 8e-28 AT3G26510 152 / 5e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.004G032200 81 / 8e-18 AT4G05150 333 / 1e-110 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.011G041100 79 / 3e-17 AT4G05150 297 / 4e-96 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.003G006200 77 / 7e-17 AT5G49920 188 / 3e-58 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.001G285800 77 / 2e-16 AT5G64430 270 / 8e-85 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.006G190200 75 / 7e-16 AT3G46920 652 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Potri.018G114300 75 / 1e-15 AT3G46920 646 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00564 PB1 PB1 domain
Representative CDS sequence
>Lus10002938 pacid=23164952 polypeptide=Lus10002938 locus=Lus10002938.g ID=Lus10002938.BGIv1.0 annot-version=v1.0
ATGGCGCCCGTCAAATTCCTCTGCAGCTACGGCGGCCAGATTCTCCCTCCCCGCTCCGGTGAATCCAAGCTTCGATATTCCGGAGGAACCACCAGAGTCC
TCTCCATCGACCTCTCCTCCACTTCCTTCTCCGATTTCATGCTCAAACTCGCCGACTTCTGCGGCGCCGCCGTCGAGATGAGGTGCCAGCTTCCCAACGG
AGATCTGGAGACGCTCGTTTCCGTCAGGTCCTTCGAGGAACTTTCCTCCGTCGTCGAGGAGTATGACCGTGTCTCTCCCGGTTCCAAGATTCGCGCAATT
CTCTCCCCTCCAAAACCGCTCCATCATCGTCAGAACAAGAAGATCAAGGTCGTCTCGCCTCTGTCGTCCATTCCCGGTTTGGATTCTAATTCGTTCAAGA
CACCCGTTCATCACCCGCTGCCGATGAGGTGTTATCCTGGTGACGTCGCTGTCGGACATCCCATCGGTCTTTACAATCACGATTCATTCGGATTCGGCTA
CTGGTACGGATACGCGAATCCTGGGTTTTCGCATGGGAATCCTGTGGGTGATTGCTTGAGCTGGCGCAATTGA
AA sequence
>Lus10002938 pacid=23164952 polypeptide=Lus10002938 locus=Lus10002938.g ID=Lus10002938.BGIv1.0 annot-version=v1.0
MAPVKFLCSYGGQILPPRSGESKLRYSGGTTRVLSIDLSSTSFSDFMLKLADFCGAAVEMRCQLPNGDLETLVSVRSFEELSSVVEEYDRVSPGSKIRAI
LSPPKPLHHRQNKKIKVVSPLSSIPGLDSNSFKTPVHHPLPMRCYPGDVAVGHPIGLYNHDSFGFGYWYGYANPGFSHGNPVGDCLSWRN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G48240 Octicosapeptide/Phox/Bem1p fam... Lus10002938 0 1
AT3G06080 TBL10 TRICHOME BIREFRINGENCE-LIKE 10... Lus10034039 7.5 0.6650
AT1G76340 GONST3 golgi nucleotide sugar transpo... Lus10034674 12.7 0.6419
AT5G54400 S-adenosyl-L-methionine-depend... Lus10037890 23.1 0.6651
AT1G67325 Ran BP2/NZF zinc finger-like s... Lus10011357 30.9 0.6630
AT2G43840 UGT74F1 UDP-glycosyltransferase 74 F1 ... Lus10017825 70.2 0.6380
AT1G75800 Pathogenesis-related thaumatin... Lus10017265 81.0 0.6309
AT5G10530 Concanavalin A-like lectin pro... Lus10042309 87.5 0.6358
AT2G26820 ATPP2-A3 phloem protein 2-A3 (.1) Lus10026891 105.1 0.6097
AT4G25470 AP2_ERF DREB1C, FTQ4, C... FREEZING TOLERANCE QTL 4, DRE/... Lus10035566 113.4 0.6274
AT2G29670 Tetratricopeptide repeat (TPR)... Lus10043203 114.0 0.6007

Lus10002938 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.