Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002962 pacid=23142134 polypeptide=Lus10002962 locus=Lus10002962.g ID=Lus10002962.BGIv1.0 annot-version=v1.0 ATGGAGGTTGACGACGACGGAGGAGGGGGAGGCGGAGGCGCCGGCAGCTCTTCCGACATCAGCACCACTAACGGCGAGGAGGTTTCCAGGATATCAACAA TCGACGAATCCGACTCCTACCAGGTTTTGTCTCTGAAGGAGGAGCCCATGGATCCGGACCCACAGTCCGACCCGGACCATCAATCTTACCCGATGGTCCC ACTCCCACTCGTTGCTATGCAGCCTGCTGCTACTTCAACGGCGGCGCGGAGGAGGCGATTATTGCTGCTACCGGGACCGGAACCGTCCCTGCTATAG
AA sequence Show only first row Show all	>Lus10002962 pacid=23142134 polypeptide=Lus10002962 locus=Lus10002962.g ID=Lus10002962.BGIv1.0 annot-version=v1.0 MEVDDDGGGGGGGAGSSSDISTTNGEEVSRISTIDESDSYQVLSLKEEPMDPDPQSDPDHQSYPMVPLPLVAMQPAATSTAARRRRLLLLPGPEPSLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10002962 [exp]	0	1
AT5G51910	TCP	TCP19	TCP family transcription facto...		Lus10002963 [exp]	1.0	0.8668
AT1G30950		UFO	UNUSUAL FLORAL ORGANS, F-box f...		Lus10007755 [exp]	3.9	0.7008
AT3G26560			ATP-dependent RNA helicase, pu...		Lus10036783 [exp]	4.2	0.7245
AT3G48560		TZP5, IMR1, ALS...	TRIAZOLOPYRIMIDINE RESISTANT 5...		Lus10032040 [exp]	20.1	0.7083
AT5G04990		ATSUN1	ARABIDOPSIS SAD1/UNC-84 DOMAIN...		Lus10028885 [exp]	23.8	0.6873
AT5G19530		ACL5	ACAULIS 5, S-adenosyl-L-methio...		Lus10004913 [exp]	28.1	0.6618
AT4G34160		CYCD3;1	CYCLIN D3;1 (.1)		Lus10002824 [exp]	29.0	0.6871
AT3G48560		TZP5, IMR1, ALS...	TRIAZOLOPYRIMIDINE RESISTANT 5...		Lus10032041 [exp]	36.5	0.6772
AT2G29380		HAI3	highly ABA-induced PP2C gene 3...		Lus10003887 [exp]	37.8	0.6849
AT1G28360	AP2_ERF	AtERF12	ERF domain protein 12 (.1)		Lus10013993 [exp]	43.7	0.6774

Compare expression of checked genes

Lus10002962 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.