Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G66815 44 / 8e-07 unknown protein AT1G47485 42 / 2e-06 unknown protein AT2G23440 42 / 2e-06 unknown protein AT5G66816 40 / 9e-06 unknown protein AT3G50610 40 / 5e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009345 [exp] 130 / 4e-41 AT2G23440 42 / 1e-06 unknown protein Lus10009347 [exp] 40 / 2e-05 AT2G23440 50 / 2e-09 unknown protein Lus10009346 [exp] 40 / 8e-05 AT3G50610 108 / 5e-28 unknown protein Lus10002970 [exp] 39 / 8e-05 AT3G50610 98 / 2e-24 unknown protein Lus10033285 [exp] 36 / 0.001 AT2G35612 42 / 1e-05 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G041400 [exp] 62 / 3e-14 AT2G23440 45 / 2e-07 unknown protein Potri.007G041500 [exp] 51 / 9e-10 AT2G23440 54 / 3e-11 unknown protein Potri.007G042000 [exp] 51 / 1e-09 AT5G66816 43 / 2e-06 unknown protein Potri.005G136800 [exp] 47 / 2e-08 AT5G66816 45 / 4e-07 unknown protein Potri.014G034500 [exp] 40 / 8e-06 AT5G66815 43 / 1e-06 unknown protein Potri.005G136700 [exp] 39 / 0.0001 AT3G50610 78 / 1e-16 unknown protein Potri.004G234800 [exp] 36 / 0.0006 AT2G35612 64 / 6e-15 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10002969 pacid=23142128 polypeptide=Lus10002969 locus=Lus10002969.g ID=Lus10002969.BGIv1.0 annot-version=v1.0 ATGGCAATCAACAGACGAATAGCAGCTTGTATCTTTGTAGTCTTTCTCATTTTGTCCCATAATCATGATCTTTCGTGCGTACAAGGCAGACATTTGAGGC GGCCGGGGAGAAGTACCAACCACCACCGGACATCGGTGAAGACTCCGGTCGTTATTGGTGGGAAGAGGGTGACGAAGATGGATTACAATGTGGACGATTT CCGACCGACGGCTCCCGGGCATAGCCCTGGGGTTGGCCACTCCATCAACAATTGA
AA sequence Show only first row Show all	>Lus10002969 pacid=23142128 polypeptide=Lus10002969 locus=Lus10002969.g ID=Lus10002969.BGIv1.0 annot-version=v1.0 MAINRRIAACIFVVFLILSHNHDLSCVQGRHLRRPGRSTNHHRTSVKTPVVIGGKRVTKMDYNVDDFRPTAPGHSPGVGHSINN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G23440			unknown protein		Lus10002969 [exp]	0	1
AT5G63810		BGAL10	beta-galactosidase 10 (.1)		Lus10023977 [exp]	3.3	0.9341
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10029390 [exp]	4.9	0.9339
AT2G28085			SAUR-like auxin-responsive pro...		Lus10021436 [exp]	5.7	0.9156
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10029913 [exp]	6.0	0.9339
AT4G25480	AP2_ERF	CBF3, DREB1A, A...	C-REPEAT BINDING FACTOR 3, de...		Lus10024491 [exp]	6.0	0.9003
					Lus10000400 [exp]	6.9	0.9339
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Lus10026877 [exp]	7.7	0.9339
AT4G25470	AP2_ERF	DREB1C, FTQ4, C...	FREEZING TOLERANCE QTL 4, DRE/...		Lus10017828 [exp]	8.5	0.8640
AT5G18460			Protein of Unknown Function (D...		Lus10006860 [exp]	8.5	0.9339
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10032159 [exp]	9.0	0.8152

Compare expression of checked genes

Lus10002969 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.